Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTJ7NXL)

DOT Name AP-1 complex subunit gamma-like 2 (AP1G2)
Synonyms Gamma2-adaptin; G2ad
Gene Name AP1G2
Related Disease
Cardiovascular disease ( )
UniProt ID
AP1G2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2E9G; 2YMT; 3ZHF; 4BCX
Pfam ID
PF01602 ; PF02883
Sequence
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHML
GYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPC
AQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVHILRTLVTMGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
RSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWC
IGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCG
DNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAK
ESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLLDLPCV
PPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKS
LQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLP
VESWQ
Function May function in protein sorting in late endosomes or multivesucular bodies (MVBs); (Microbial infection) Involved in MVB-assisted maturation of hepatitis B virus (HBV).
Tissue Specificity Expressed in all but one (skeletal muscle) tissues examined.
KEGG Pathway
Lysosome (hsa04142 )
Human immunodeficiency virus 1 infection (hsa05170 )
Reactome Pathway
Lysosome Vesicle Biogenesis (R-HSA-432720 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiovascular disease DIS2IQDX Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of AP-1 complex subunit gamma-like 2 (AP1G2). [2]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [4]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [5]
Temozolomide DMKECZD Approved Temozolomide increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [6]
Triclosan DMZUR4N Approved Triclosan increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [7]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of AP-1 complex subunit gamma-like 2 (AP1G2). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.BMC Cardiovasc Disord. 2011 Jun 10;11:29. doi: 10.1186/1471-2261-11-29.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
8 Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
9 Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.