Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTONRCH)

• DOT Name: Ankyrin repeat and SOCS box protein 13 (ASB13)
• Synonyms: ASB-13
• Gene Name: ASB13
• UniProt ID: ASB13_HUMAN
• Pfam ID: PF00023 ; PF12796 ; PF07525
• Sequence:
  MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAAS
  LQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
  LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
  LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
  TLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
• Function: May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Reactome Pathway:
  Antigen processing (R-HSA-983168)
  Neddylation (R-HSA-8951664)

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[5]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[10]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Ankyrin repeat and SOCS box protein 13 (ASB13).	[11]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [9] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [10] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [11] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.