Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU5A9A1)

• DOT Name: SOSS complex subunit C (INIP)
• Synonyms: INTS3- and NABP-interacting protein; Sensor of single-strand DNA complex subunit C; Sensor of ssDNA subunit C; SOSS-C; Single-stranded DNA-binding protein-interacting protein 1; SSB-interacting protein 1; hSSBIP1
• Gene Name: INIP
• Related Disease: Specific language impairment
• UniProt ID: SOSSC_HUMAN
• PDB ID: 4OWT; 4OWW
• Pfam ID: PF15925
• Sequence:
  MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAE
  QQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
• Function: Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Specific language impairment	DISEKRML	Strong	Genetic Variation	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of SOSS complex subunit C (INIP).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SOSS complex subunit C (INIP).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SOSS complex subunit C (INIP).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of SOSS complex subunit C (INIP).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of SOSS complex subunit C (INIP).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of SOSS complex subunit C (INIP).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of SOSS complex subunit C (INIP).	[8]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of SOSS complex subunit C (INIP).	[9]

References

• [1] Genome-wide screening for DNA variants associated with reading and language traits.Genes Brain Behav. 2014 Sep;13(7):686-701. doi: 10.1111/gbb.12158. Epub 2014 Aug 29.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [7] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [9] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.