Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUB0OQJ)

DOT Name	Small lysine-rich protein 1 (SMKR1)
Gene Name	SMKR1
UniProt ID	SMKR1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGK KGRSK

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Small lysine-rich protein 1 (SMKR1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small lysine-rich protein 1 (SMKR1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Small lysine-rich protein 1 (SMKR1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Small lysine-rich protein 1 (SMKR1).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Small lysine-rich protein 1 (SMKR1).	[5]
------------------------------------------------------------------------------------

References

1	Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
2	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
3	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.