Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUJT8F9)

• DOT Name: Suppressor APC domain-containing protein 1 (SAPCD1)
• Synonyms: Protein G7d
• Gene Name: SAPCD1
• Related Disease: Rheumatoid arthritis
• UniProt ID: SAPC1_HUMAN
• Pfam ID: PF11414
• Sequence:
  MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQ
  HGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELS
  RQQKGVTQPKEEMAQRGCTKGPRGPTRV

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[6]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Suppressor APC domain-containing protein 1 (SAPCD1).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Suppressor APC domain-containing protein 1 (SAPCD1).	[4]

References

• [1] HLA-DPB1-COL11A2 and three additional xMHC loci are independently associated with RA in a UK cohort.Genes Immun. 2011 Apr;12(3):169-75. doi: 10.1038/gene.2010.57. Epub 2011 Feb 3.
• [2] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [7] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.