Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUOGSDJ)

• DOT Name: Programmed cell death protein 2 (PDCD2)
• Synonyms: Zinc finger MYND domain-containing protein 7; Zinc finger protein Rp-8
• Gene Name: PDCD2
• UniProt ID: PDCD2_HUMAN
• Pfam ID: PF04194 ; PF01753
• Sequence:
  MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
  LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
  GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
  IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
  FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
  LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP
• Function: May be a DNA-binding protein with a regulatory function. May play an important role in cell death and/or in regulation of cell proliferation.
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Programmed cell death protein 2 (PDCD2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Programmed cell death protein 2 (PDCD2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Programmed cell death protein 2 (PDCD2).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Programmed cell death protein 2 (PDCD2).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Programmed cell death protein 2 (PDCD2).	[5]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Programmed cell death protein 2 (PDCD2).	[6]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline increases the expression of Programmed cell death protein 2 (PDCD2).	[7]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Programmed cell death protein 2 (PDCD2).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Programmed cell death protein 2 (PDCD2).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Programmed cell death protein 2 (PDCD2).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Programmed cell death protein 2 (PDCD2).	[9]

References

• [1] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [5] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [6] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [7] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [8] Differential expression of genes induced by resveratrol in LNCaP cells: P53-mediated molecular targets. Int J Cancer. 2003 Mar 20;104(2):204-12.
• [9] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.