Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUQA9JT)

DOT Name RING finger protein 39 (RNF39)
Synonyms Protein HZFw
Gene Name RNF39
Related Disease
Acquired immune deficiency syndrome ( )
Behcet disease ( )
HIV infectious disease ( )
Lung adenocarcinoma ( )
Myasthenia gravis ( )
Type-1 diabetes ( )
Systemic lupus erythematosus ( )
Coronary heart disease ( )
Lung cancer ( )
UniProt ID
RNF39_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13765 ; PF00622 ; PF13445
Sequence
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES
Function May play a role in prolonged long term-potentiation (LTP) maintenance.
Tissue Specificity Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acquired immune deficiency syndrome DISL5UOX Strong Genetic Variation [1]
Behcet disease DISSYMBS Strong Biomarker [2]
HIV infectious disease DISO97HC Strong Genetic Variation [3]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [4]
Myasthenia gravis DISELRCI Strong Genetic Variation [5]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [6]
Systemic lupus erythematosus DISI1SZ7 moderate Genetic Variation [7]
Coronary heart disease DIS5OIP1 Limited Biomarker [8]
Lung cancer DISCM4YA Limited Genetic Variation [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of RING finger protein 39 (RNF39). [10]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of RING finger protein 39 (RNF39). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of RING finger protein 39 (RNF39). [10]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of RING finger protein 39 (RNF39). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of RING finger protein 39 (RNF39). [13]
------------------------------------------------------------------------------------

References

1 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).J Infect Dis. 2009 Feb 1;199(3):419-26. doi: 10.1086/596067.
2 TRIM39 and RNF39 are associated with Behet's disease independently of HLA-B?1 and -A?6.Biochem Biophys Res Commun. 2010 Oct 29;401(4):533-7. doi: 10.1016/j.bbrc.2010.09.088. Epub 2010 Sep 27.
3 The HLA-B/-C haplotype block contains major determinants for host control of HIV.Genes Immun. 2009 Dec;10(8):673-7. doi: 10.1038/gene.2009.58. Epub 2009 Aug 20.
4 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.Am J Hum Genet. 2009 Nov;85(5):679-91. doi: 10.1016/j.ajhg.2009.09.012. Epub 2009 Oct 15.
5 Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
6 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
7 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
8 Genetic loci associated with nonobstructive coronary artery disease in Caucasian women.Physiol Genomics. 2016 Jan;48(1):12-20. doi: 10.1152/physiolgenomics.00067.2015. Epub 2015 Nov 3.
9 Influence of common genetic variation on lung cancer risk: meta-analysis of 14 900 cases and 29 485 controls.Hum Mol Genet. 2012 Nov 15;21(22):4980-95. doi: 10.1093/hmg/dds334. Epub 2012 Aug 16.
10 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
11 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
12 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.