Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVDRDGX)

• DOT Name: Cilia- and flagella-associated protein 91 (CFAP91)
• Synonyms: CFAP91; AMY-1-associating protein expressed in testis 1; AAT-1; MYCBP/AMY-1-associated testis-expressed protein 1; Protein MAATS1
• Gene Name: CFAP91
• UniProt ID: CFA91_HUMAN
• PDB ID: 8J07
• Pfam ID: PF14738
• Sequence:
  MSHAVTIEEPQAQPQVSQTRYRERSRAGSHISSNRAYDFLYDPLFIVSSEKDHTQANIQA
  TLIRSRLRKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTT
  TDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSKAEPYTFPPTSTKH
  LSIPSKSTVGTQTDYRDADVQTDPYSAEYVVCQDSIPELLTLATLTWGRGLPAGQAEVEM
  IERAREKRAWEASLPALSDTSQFEKRRKMMNEMERKEWAFREQEIEKLQEIRLEVLKELL
  RKREENQNEVNMKHLNARWSKLQEGKEAKMAKIQRTHVSTIRKLVGKRKNIEGKLERRNI
  IKDYSDYASQVYGPLSRLGCFPDNNSEDFVVKNYYLNTYEGLVELESCLPDFVTQPQIRA
  PKPKVITTKAGFLKRAARLDYELAEVHKALLDKKNKVLEVKKPPRFLQRNPIPQPRLPTP
  TLEMTSNEEEEMEMAVIYLQKLLRGRVVQNMMFEGKEKRLELIQELRTCHALQEDEKLVK
  KAEKQVTLALQRQRNLHEHKVSLVENHLAGLEGRALADMFDFLSKELVRLQEERRIHAFV
  MLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANTAE
  EQARAEIEKMAEKINDIAYEMESRRTYLQSEEIVAELVYSFLIPEVQKYFVKEKVRNAQR
  KHILAAHQIIHSYTESMVQKKLTEGEQDEASNAAMLLEKETQNENNS
• Function: Involved in sperm flagellum axonemal organization and function. May regulate cilium motility through its role in the assembly of the axonemal radial spokes.
• Tissue Specificity: .Strongly expressed in the liver.; [Isoform 7]: Widely expressed, but strongly expressed in all spermatogenesis-related tissues, including the testis, the epithelium of cauda and the corpus epididymis, as well as the spermatid and mature sperm. Also expressed in Leydig cells.

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cilia- and flagella-associated protein 91 (CFAP91).	[1]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Cilia- and flagella-associated protein 91 (CFAP91).	[2]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Cilia- and flagella-associated protein 91 (CFAP91).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Cilia- and flagella-associated protein 91 (CFAP91).	[2]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cilia- and flagella-associated protein 91 (CFAP91).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cilia- and flagella-associated protein 91 (CFAP91).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [3] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.