Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWI587R)

DOT Name Nucleolar protein 4 (NOL4)
Synonyms Nucleolar-localized protein
Gene Name NOL4
Related Disease
Advanced cancer ( )
Cervical cancer ( )
Cervical carcinoma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Head-neck squamous cell carcinoma ( )
Narcolepsy ( )
Schizophrenia ( )
Neoplasm ( )
UniProt ID
NOL4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSK
GFQLGQPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETG
PNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKP
PTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSAVNSDLSS
NLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSREMGDSNSDGKTGLEQD
EQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENGSKSPAHSYSS
YDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPI
PSHLTSAVAESILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPG
SQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQ
LSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN
Tissue Specificity Expressed predominantly in fetal brain, adult brain and testis.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
Cervical cancer DISFSHPF Strong Biomarker [1]
Cervical carcinoma DIST4S00 Strong Biomarker [1]
Head and neck cancer DISBPSQZ Strong Posttranslational Modification [2]
Head and neck carcinoma DISOU1DS Strong Posttranslational Modification [2]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [2]
Narcolepsy DISLCNLI Strong Genetic Variation [3]
Schizophrenia DISSRV2N Strong Genetic Variation [4]
Neoplasm DISZKGEW Limited Biomarker [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Nucleolar protein 4 (NOL4). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Nucleolar protein 4 (NOL4). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Nucleolar protein 4 (NOL4). [10]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Nucleolar protein 4 (NOL4). [12]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Nucleolar protein 4 (NOL4). [7]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Nucleolar protein 4 (NOL4). [8]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of Nucleolar protein 4 (NOL4). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Nucleolar protein 4 (NOL4). [11]
------------------------------------------------------------------------------------

References

1 Identification of novel methylation markers in cervical cancer using restriction landmark genomic scanning.Cancer Res. 2008 Apr 1;68(7):2489-97. doi: 10.1158/0008-5472.CAN-07-3194.
2 Validation of nucleolar protein 4 as a novel methylated tumor suppressor gene in head and neck cancer.Oncol Rep. 2014 Feb;31(2):1014-20. doi: 10.3892/or.2013.2927. Epub 2013 Dec 16.
3 Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
4 Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
5 FAK activity protects nucleostemin in facilitating breast cancer spheroid and tumor growth.Breast Cancer Res. 2015 Mar 28;17:47. doi: 10.1186/s13058-015-0551-x.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.