Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXBRQFR)

DOT Name Kelch repeat and BTB domain-containing protein 4 (KBTBD4)
Synonyms BTB and kelch domain-containing protein 4
Gene Name KBTBD4
Related Disease
Medulloblastoma ( )
Venous thromboembolism ( )
UniProt ID
KBTB4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2EQX
Pfam ID
PF07707 ; PF00651 ; PF07646
Sequence
MESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQLHR
LVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIYHGTVKLRAEELQEIYE
VSDMYQLTSLFEECSRFLARTVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNT
EEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFAESLRTSLKEIGENVHI
YLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCHQITAACKHGGDLYVVGGSIPRRMWK
CNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTLSNAVIYYRVGDNVWTE
TTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTKPSRLIQCFDTETDKCHVKPYVLPFA
GRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCLPEAWSSAPSLWKIASCNGSIYVFR
DRYKKGDANTYKLDPATSAVTVTRGIKVLLTNLQFVLA

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Medulloblastoma DISZD2ZL Strong Genetic Variation [1]
Venous thromboembolism DISUR7CR Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [9]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [6]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Kelch repeat and BTB domain-containing protein 4 (KBTBD4). [10]
------------------------------------------------------------------------------------

References

1 Lack of KBTBD4 Mutations in Molecularly Classified Brazilian Medulloblastomas.J Neuropathol Exp Neurol. 2019 Sep 1;78(9):788-790. doi: 10.1093/jnen/nlz066.
2 Genomic and transcriptomic association studies identify 16 novel susceptibility loci for venous thromboembolism.Blood. 2019 Nov 7;134(19):1645-1657. doi: 10.1182/blood.2019000435.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.