Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXC8QBG)

• DOT Name: Putative transmembrane protein INAFM1 (INAFM1)
• Synonyms: InaF-motif-containing protein 1; Proline-rich protein 24
• Gene Name: INAFM1
• UniProt ID: INAM1_HUMAN
• Pfam ID: PF15018
• Sequence:
  MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRS
  PAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDP
  DRRPSRQTPRETPEAAEGRRPG

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Putative transmembrane protein INAFM1 (INAFM1).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative transmembrane protein INAFM1 (INAFM1).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.