Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXI778H)

• DOT Name: Interferon alpha-inducible protein 27-like protein 1 (IFI27L1)
• Synonyms: Interferon-stimulated gene 12c protein; ISG12(c); ISG12C
• Gene Name: IFI27L1
• UniProt ID: I27L1_HUMAN
• PDB ID: 2LOQ
• Pfam ID: PF06140
• Sequence:
  MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGG
  GVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
• Function: Plays a role in the apoptotic process and has a pro-apoptotic activity.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[4]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin affects the expression of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Interferon alpha-inducible protein 27-like protein 1 (IFI27L1).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.