Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOYT29)

• DOT Name: Fc receptor-like protein 1 (FCRL1)
• Synonyms: FcR-like protein 1; FcRL1; Fc receptor homolog 1; FcRH1; IFGP family protein 1; hIFGP1; Immune receptor translocation-associated protein 5; CD antigen CD307a
• Gene Name: FCRL1
• Related Disease:
  Acute lymphocytic leukaemia
  Graves disease
  Hepatocellular carcinoma
  Multiple sclerosis
  Neoplasm
  Small lymphocytic lymphoma
  Hashimoto thyroiditis
  Hepatitis B virus infection
  Advanced cancer
  Mantle cell lymphoma
  Marginal zone lymphoma
• UniProt ID: FCRL1_HUMAN
• Pfam ID: PF13927
• Sequence:
  MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRA
  LGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPP
  GGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQ
  YYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILY
  WFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA
  RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLPQEFTYLNSP
  TPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI
  TDVDYEDAM
• Function: May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation.
• Tissue Specificity: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Graves disease	DISU4KOQ	Strong	Altered Expression	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[3]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[5]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[5]
Hashimoto thyroiditis	DIS77CDF	moderate	Altered Expression	[2]
Hepatitis B virus infection	DISLQ2XY	moderate	Altered Expression	[6]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[5]
Mantle cell lymphoma	DISFREOV	Limited	Altered Expression	[5]
Marginal zone lymphoma	DISLZ4AO	Limited	Altered Expression	[5]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Fc receptor-like protein 1 (FCRL1).	[7]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Fc receptor-like protein 1 (FCRL1).	[8]

References

• [1] Low representation of Fc receptor-like 1-5 molecules in leukemic cells from Iranian patients with acute lymphoblastic leukemia.Cancer Immunol Immunother. 2009 Jun;58(6):989-96. doi: 10.1007/s00262-008-0589-z. Epub 2008 Sep 19.
• [2] Expression Profile of Human Fc Receptor-Like 1, 2, and 4 Molecules in Peripheral Blood Mononuclear Cells of Patients with Hashimoto's Thyroiditis and Graves' Disease.Horm Metab Res. 2015 Aug;47(9):693-8. doi: 10.1055/s-0035-1545280. Epub 2015 Mar 4.
• [3] Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.PLoS One. 2013 Aug 7;8(8):e68439. doi: 10.1371/journal.pone.0068439. eCollection 2013.
• [4] Analysis of immune-related loci identifies 48 new susceptibility variants for multiple sclerosis.Nat Genet. 2013 Nov;45(11):1353-60. doi: 10.1038/ng.2770. Epub 2013 Sep 29.
• [5] Evaluation of CD307a expression patterns during normal B-cell maturation and in B-cell malignancies by flow cytometry.Cytometry B Clin Cytom. 2018 Jul;94(4):588-595. doi: 10.1002/cyto.b.21631. Epub 2018 Mar 9.
• [6] Overexpression of Fc receptor-like 1 associated with B-cell activation during hepatitis B virus infection.Braz J Med Biol Res. 2012 Dec;45(12):1112-8. doi: 10.1590/s0100-879x2012007500130. Epub 2012 Aug 16.
• [7] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [8] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.