Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXPQDWN)

• DOT Name: Purine-rich element-binding protein gamma (PURG)
• Synonyms: Purine-rich element-binding protein G
• Gene Name: PURG
• Related Disease:
  Non-insulin dependent diabetes
  Neoplasm
• UniProt ID: PURG_HUMAN
• Pfam ID: PF04845
• Sequence:
  MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQEL
  ASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLG
  DFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDN
  RKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLI
  EDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTI
  TVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD
• Tissue Specificity: Isoform 1 is expressed in testis and glioblastoma. Isoform 2 is expressed in fetal lung.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[1]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Purine-rich element-binding protein gamma (PURG).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Purine-rich element-binding protein gamma (PURG).	[7]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Purine-rich element-binding protein gamma (PURG).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Purine-rich element-binding protein gamma (PURG).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Purine-rich element-binding protein gamma (PURG).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Purine-rich element-binding protein gamma (PURG).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Purine-rich element-binding protein gamma (PURG).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Purine-rich element-binding protein gamma (PURG).	[9]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of Purine-rich element-binding protein gamma (PURG).	[10]

References

• [1] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [2] The Pur protein family: clues to function from recent studies on cancer and AIDS.Anticancer Res. 2003 May-Jun;23(3A):2093-100.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [10] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.