Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXWTWQ9)

• DOT Name: BPI fold-containing family B member 2 (BPIFB2)
• Synonyms: Bactericidal/permeability-increasing protein-like 1; BPI-like 1; Long palate, lung and nasal epithelium carcinoma-associated protein 2; RYSR
• Gene Name: BPIFB2
• Related Disease:
  Nasal polyp
  Acute myelogenous leukaemia
• UniProt ID: BPIB2_HUMAN
• Pfam ID: PF01273 ; PF02886
• Sequence:
  MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWS
  GEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADT
  RVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNL
  VQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT
  PFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRL
  IPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDV
  VVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNA
  LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS
• Tissue Specificity: Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver.
• Reactome Pathway:
  Antimicrobial peptides (R-HSA-6803157)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nasal polyp	DISLP3XE	Strong	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[2]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of BPI fold-containing family B member 2 (BPIFB2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin affects the expression of BPI fold-containing family B member 2 (BPIFB2).	[4]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of BPI fold-containing family B member 2 (BPIFB2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of BPI fold-containing family B member 2 (BPIFB2).	[6]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of BPI fold-containing family B member 2 (BPIFB2).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of BPI fold-containing family B member 2 (BPIFB2).	[5]

References

• [1] Reduced expression of antimicrobial PLUNC proteins in nasal polyp tissues of patients with chronic rhinosinusitis.Allergy. 2012 Jul;67(7):920-8. doi: 10.1111/j.1398-9995.2012.02848.x.
• [2] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.