Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY08TMQ)

• DOT Name: Galectin-2 (LGALS2)
• Synonyms: Gal-2; Beta-galactoside-binding lectin L-14-II; HL14; Lactose-binding lectin 2; S-Lac lectin 2
• Gene Name: LGALS2
• UniProt ID: LEG2_HUMAN
• PDB ID: 1HLC; 5DG1; 5DG2; 5EWS
• Pfam ID: PF00337
• Sequence:
  MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSL
  DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVR
  GGFNMSSFKLKE
• Function: This protein binds beta-galactoside. Its physiological function is not yet known.

Molecular Interaction Atlas (MIA) of This DOT

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Galectin-2 (LGALS2).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Galectin-2 (LGALS2).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Galectin-2 (LGALS2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Galectin-2 (LGALS2).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Galectin-2 (LGALS2).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Galectin-2 (LGALS2).	[6]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galectin-2 (LGALS2).	[7]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Galectin-2 (LGALS2).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Galectin-2 (LGALS2).	[9]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Galectin-2 (LGALS2).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Galectin-2 (LGALS2).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Galectin-2 (LGALS2).	[10]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Galectin-2 (LGALS2).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Galectin-2 (LGALS2).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Galectin-2 (LGALS2).	[12]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies. Leuk Res. 2008 Feb;32(2):275-85. doi: 10.1016/j.leukres.2007.05.024. Epub 2007 Jul 19.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [11] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [12] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [13] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.