General Information of Drug Off-Target (DOT) (ID: OTYOSAKM)

DOT Name Thioredoxin domain-containing protein 15
Gene Name TXNDC15
Related Disease
Meckel syndrome 14 ( )
Meckel syndrome ( )
UniProt ID
TXD15_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00085
Sequence
MVPAAGRRPPRVMRLLGWWQVLLWVLGLPVRGVEVAEESGRLWSEEQPAHPLQVGAVYLG
EEELLHDPMGQDRAAEEANAVLGLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAE
DSRCNVRESLFSLDGAGAHFPDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEER
NITGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAFPAL
HFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAK
KNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHVE
Function Acts as a positive regulator of ciliary hedgehog signaling. Involved in ciliogenesis.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Meckel syndrome 14 DISZJ0D2 Strong Autosomal recessive [1]
Meckel syndrome DISXPHOY Moderate Autosomal recessive [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Thioredoxin domain-containing protein 15. [3]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Thioredoxin domain-containing protein 15. [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Thioredoxin domain-containing protein 15. [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Thioredoxin domain-containing protein 15. [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Thioredoxin domain-containing protein 15. [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Thioredoxin domain-containing protein 15. [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Thioredoxin domain-containing protein 15. [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Thioredoxin domain-containing protein 15. [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 The primary health care team - what you told us. Community Outlook. 1978 Sep 14:272-5.
2 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
3 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.