Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYSXAX6)

DOT Name Cleavage stimulation factor subunit 1 (CSTF1)
Synonyms CF-1 50 kDa subunit; Cleavage stimulation factor 50 kDa subunit; CSTF 50 kDa subunit; CstF-50
Gene Name CSTF1
Related Disease
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
CSTF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6B3X
Pfam ID
PF16699 ; PF00400
Sequence
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMEN
DDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDG
QLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLA
FHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPT
LRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAV
FNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD
Function
One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.
KEGG Pathway
mR. surveillance pathway (hsa03015 )
Reactome Pathway
Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203 )
RNA Polymerase II Transcription Termination (R-HSA-73856 )
Processing of Intronless Pre-mRNAs (R-HSA-77595 )
mRNA 3'-end processing (R-HSA-72187 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Genetic Variation [1]
Breast carcinoma DIS2UE88 Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cleavage stimulation factor subunit 1 (CSTF1). [2]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Cleavage stimulation factor subunit 1 (CSTF1). [9]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [6]
Marinol DM70IK5 Approved Marinol decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [7]
Clozapine DMFC71L Approved Clozapine decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [10]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Cleavage stimulation factor subunit 1 (CSTF1). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.PLoS One. 2015 Apr 1;10(4):e0120020. doi: 10.1371/journal.pone.0120020. eCollection 2015.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
8 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
9 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
10 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
11 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.