Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ5X6IM)

DOT Name Dyslexia-associated protein KIAA0319-like protein (KIAA0319L)
Synonyms Adeno-associated virus receptor; AAVR
Gene Name KIAA0319L
Related Disease
Autoimmune disease ( )
Periventricular nodular heterotopia ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
Episodic kinesigenic dyskinesia 1 ( )
Polycystic kidney disease ( )
UniProt ID
K319L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2YRL; 6IHB; 6JCQ; 6JCS; 6NZ0; 7KPN; 7TI5; 7WJX; 7WQP
Pfam ID
PF18911
Sequence
MEKRLGVKPNPASWILSGYYWQTSAKWLRSLYLFYTCFCFSVLWLSTDASESRCQQGKTQ
FGVGLRSGGENHLWLLEGTPSLQSCWAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFR
THSSNSMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQ
SLIRKLQKRGSPSDVVTPIVTQHSKVNDSNELGGLTTSGSAEVHKAITISSPLTTDLTAE
LSGGPKNVSVQPEISEGLATTPSTQQVKSSEKTQIAVPQPVAPSYSYATPTPQASFQSTS
APYPVIKELVVSAGESVQITLPKNEVQLNAYVLQEPPKGETYTYDWQLITHPRDYSGEME
GKHSQILKLSKLTPGLYEFKVIVEGQNAHGEGYVNVTVKPEPRKNRPPIAIVSPQFQEIS
LPTTSTVIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVV
DSDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSL
SPSSKGKVVEMQGVRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENNKPPQ
ADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLWEKTQGPDGVQLENANSSVATVTGLQV
GTYVFTLTVKDERNLQSQSSVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDD
KGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTV
EVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGVLDSDIIVQKIQPYTEQSTK
MVFFVQNEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSF
TKRCICDPFWMENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGILSWTVICCCKRQKG
KPKRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDRE
KGKLLHGQNGSVPNGQTPLKARSPREEIL
Function
Possible role in axon guidance through interaction with RTN4R; (Microbial infection) Acts as a receptor for adeno-associated virus and is involved in adeno-associated virus infection through endocytosis system.
Tissue Specificity Expressed in cortical neurons in the brain cortex (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Strong Genetic Variation [1]
Periventricular nodular heterotopia DISU3ZRI Strong Altered Expression [2]
Systemic lupus erythematosus DISI1SZ7 Strong SusceptibilityMutation [1]
Systemic sclerosis DISF44L6 Strong Genetic Variation [1]
Episodic kinesigenic dyskinesia 1 DISGVQMP Limited Genetic Variation [3]
Polycystic kidney disease DISWS3UY Limited Genetic Variation [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [10]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [13]
Coumarin DM0N8ZM Investigative Coumarin affects the phosphorylation of Dyslexia-associated protein KIAA0319-like protein (KIAA0319L). [12]
------------------------------------------------------------------------------------

References

1 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.Hum Mol Genet. 2013 Oct 1;22(19):4021-9. doi: 10.1093/hmg/ddt248. Epub 2013 Jun 4.
2 Embryonic disruption of the candidate dyslexia susceptibility gene homolog Kiaa0319-like results in neuronal migration disorders.Neuroscience. 2013 Sep 17;248:585-93. doi: 10.1016/j.neuroscience.2013.06.056. Epub 2013 Jul 3.
3 Adeno-associated virus 2 bound to its cellular receptor AAVR.Nat Microbiol. 2019 Apr;4(4):675-682. doi: 10.1038/s41564-018-0356-7. Epub 2019 Feb 11.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.