General Information of Drug Off-Target (DOT) (ID: OTZOQ2ZM)

DOT Name Vesicle-associated membrane protein 2
Synonyms VAMP-2; Synaptobrevin-2
Gene Name VAMP2
Related Disease
Intellectual disability, autosomal dominant 40 ( )
Neurodevelopmental disorder with hypotonia and autistic features with or without hyperkinetic movements ( )
UniProt ID
VAMP2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3FIE; 3FII; 3RK2; 3RK3; 3RL0; 7UDC
Pfam ID
PF00957
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Tissue Specificity Nervous system and skeletal muscle.
KEGG Pathway
S.RE interactions in vesicular transport (hsa04130 )
Sy.ptic vesicle cycle (hsa04721 )
Insulin secretion (hsa04911 )
Vasopressin-regulated water reabsorption (hsa04962 )
Salivary secretion (hsa04970 )
Reactome Pathway
Serotonin Neurotransmitter Release Cycle (R-HSA-181429 )
Norepinephrine Neurotransmitter Release Cycle (R-HSA-181430 )
trans-Golgi Network Vesicle Budding (R-HSA-199992 )
Glutamate Neurotransmitter Release Cycle (R-HSA-210500 )
Dopamine Neurotransmitter Release Cycle (R-HSA-212676 )
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642 )
Insulin processing (R-HSA-264876 )
Regulation of insulin secretion (R-HSA-422356 )
Lysosome Vesicle Biogenesis (R-HSA-432720 )
Golgi Associated Vesicle Biogenesis (R-HSA-432722 )
Other interleukin signaling (R-HSA-449836 )
Toxicity of botulinum toxin type D (botD) (R-HSA-5250955 )
Toxicity of botulinum toxin type B (botB) (R-HSA-5250958 )
Toxicity of botulinum toxin type F (botF) (R-HSA-5250981 )
Toxicity of tetanus toxin (tetX) (R-HSA-5250982 )
Toxicity of botulinum toxin type G (botG) (R-HSA-5250989 )
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
Clathrin-mediated endocytosis (R-HSA-8856828 )
GABA synthesis, release, reuptake and degradation (R-HSA-888590 )
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane (R-HSA-9609523 )
Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360 )
Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Intellectual disability, autosomal dominant 40 DISAI0IH Strong Autosomal dominant [1]
Neurodevelopmental disorder with hypotonia and autistic features with or without hyperkinetic movements DISOKUGK Strong Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Vesicle-associated membrane protein 2. [2]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Vesicle-associated membrane protein 2. [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Vesicle-associated membrane protein 2. [4]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Vesicle-associated membrane protein 2. [6]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Vesicle-associated membrane protein 2. [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Vesicle-associated membrane protein 2. [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Vesicle-associated membrane protein 2. [10]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Vesicle-associated membrane protein 2. [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Vesicle-associated membrane protein 2. [12]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Vesicle-associated membrane protein 2. [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic decreases the methylation of Vesicle-associated membrane protein 2. [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Vesicle-associated membrane protein 2. [9]
------------------------------------------------------------------------------------

References

1 Mutations in the Neuronal Vesicular SNARE VAMP2 Affect Synaptic Membrane Fusion and Impair Human Neurodevelopment. Am J Hum Genet. 2019 Apr 4;104(4):721-730. doi: 10.1016/j.ajhg.2019.02.016. Epub 2019 Mar 28.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Arsenic and the epigenome: interindividual differences in arsenic metabolism related to distinct patterns of DNA methylation. J Biochem Mol Toxicol. 2013 Feb;27(2):106-15. doi: 10.1002/jbt.21462. Epub 2013 Jan 11.
6 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
7 Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
11 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
12 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
13 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.