Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZOXUEK)

• DOT Name: Protein FAM200C (FAM200C)
• Synonyms: Protein ZBED8; Transposon-derived Buster3 transposase-like protein; Zinc finger BED domain-containing protein 8
• Gene Name: FAM200C
• UniProt ID: F200C_HUMAN
• Sequence:
  MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAG
  HDLNSLKHMPAPSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCA
  LEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETT
  DMDDCSQLMAFVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSV
  CTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINF
  IKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSN
  LVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIE
  KRNFTNFPFLEEIIVSDNEGIFIAAEITLHLQQLSNFFHGYFSIGDLNEASKWILDPFLF
  NIDFVDDSYLMKNDLAELRASGQILMEFETMKLEDFWCAQFTAFPNLAKTALEILMPFAT
  TYLCELGFSSLLHFKTKSRSCFNLSDDIRVAISKKVPRFSDIIEQKLQLQQKSL

Molecular Interaction Atlas (MIA) of This DOT

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein FAM200C (FAM200C).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein FAM200C (FAM200C).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM200C (FAM200C).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein FAM200C (FAM200C).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein FAM200C (FAM200C).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein FAM200C (FAM200C).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein FAM200C (FAM200C).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein FAM200C (FAM200C).	[8]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Protein FAM200C (FAM200C).	[9]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Protein FAM200C (FAM200C).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein FAM200C (FAM200C).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Protein FAM200C (FAM200C).	[11]
GSK618334	DMJPXZ4	Phase 1	GSK618334 increases the expression of Protein FAM200C (FAM200C).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM200C (FAM200C).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein FAM200C (FAM200C).	[13]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein FAM200C (FAM200C).	[14]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein FAM200C (FAM200C).	[15]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Protein FAM200C (FAM200C).	[10]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the expression of Protein FAM200C (FAM200C).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [9] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [10] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [11] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [12] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [13] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [14] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [15] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.