Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZZ0R2I)

• DOT Name: Uncharacterized protein C6orf226 (C6ORF226)
• Gene Name: C6ORF226
• UniProt ID: CF226_HUMAN
• Pfam ID: PF17733
• Sequence:
  MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKP
  WEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Uncharacterized protein C6orf226 (C6ORF226).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Uncharacterized protein C6orf226 (C6ORF226).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Uncharacterized protein C6orf226 (C6ORF226).	[2]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Uncharacterized protein C6orf226 (C6ORF226).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein C6orf226 (C6ORF226).	[4]

References

• [1] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [2] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [3] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [4] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.