Details of the Drug
General Information of Drug (ID: DMFOIA8)
Drug Name |
Nesiritide
|
||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | Natrecor (TN) | ||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||
Affected Organisms |
Humans and other mammals
|
||||||||||||||||||||||
ATC Code | |||||||||||||||||||||||
Drug Type |
Small molecular drug
|
||||||||||||||||||||||
Sequence |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
|
||||||||||||||||||||||
Structure |
![]() |
||||||||||||||||||||||
3D MOL is unavailable | 2D MOL | ||||||||||||||||||||||
#Ro5 Violations (Lipinski): 5 | Molecular Weight (mw) | 3464 | |||||||||||||||||||||
Logarithm of the Partition Coefficient (xlogp) | -16.7 | ||||||||||||||||||||||
Rotatable Bond Count (rotbonds) | 91 | ||||||||||||||||||||||
Hydrogen Bond Donor Count (hbonddonor) | 56 | ||||||||||||||||||||||
Hydrogen Bond Acceptor Count (hbondacc) | 55 | ||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||
Chemical Identifiers |
|
||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
Coadministration of a Drug Treating the Disease Different from Nesiritide (Comorbidity)
|
References