Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTQ23VB)

• DTP Name: Organic anion transporter 1 (SLC22A6)
• Gene Name: SLC22A6
• UniProt ID: Q4U2R8 (S22A6_HUMAN)
• VARIDT ID: DTD0024
• Synonyms: OAT1; PAH transporter; PAHT; ROAT1; Renal organic anion transporter 1; SLC22A6; Solute carrier family 22 member 6; hOAT1; hPAHT; hROAT1
• DTP Family:
  Major Facilitator Superfamily (MFS)
  Organic Cation Transporter (OCT) Family
• Tissue Specificity: Strongly expressed in kidney and to a lowerextent in liver, skeletal muscle, brain and placenta. Found at thebasolateral membrane of the proximal tubule.
• Sequence:
  MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
  GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
  VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
  FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
  AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
  GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
  QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
  IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
  LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
  RQQQEHQKYMVPLQASAQEKNGL
• Function: This transporter involved in the renal elimination of endogenous and exogenous organic anions. Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS). Mediates the sodium-independent uptake of p-aminohippurate (PAH), ochratoxin (OTA), acyclovir (ACV), 3'-azido-3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS) and 3-carboxy-4-methyl-5-propyl-2-furanpropionate (CMPF), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP) and edaravone sulfate. PAH uptake is inhibited by p-chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), sulindac, diclofenac, carprofen, glutarate and okadaic acid. PAH uptake is inhibited by benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, furosemide, indomethacin, bumetamide, losartan, probenecid, phenol red, urate, and alpha-ketoglutarate.
• Endogenous Substrate(s): Organic anions
• TCDB ID: 2.A.1.19.31
• Gene ID: 9356
• Reactome Pathway: Organic anion transport (R-HSA-561048)

Molecular Interaction Atlas (MIA) of This DTP

23 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aciclovir	DMYLOVR	Genital herpes	1A94	Approved	[1]
Adefovir	DMM278X	N. A.	N. A.	Approved	[2]
Alprostadil	DMWH7NQ	Aorta coarctation		Approved	[3]
Amoxicillin	DMUYNEI	Acute otitis media	AB00	Approved	[4]
Cefaclor	DMJXDGC	Bacterial infection	1A00-1C4Z	Approved	[5]
Cefazolin	DMPDYFR	Bacteremia	1A73	Approved	[6]
Ceftizoxime	DM3VOGS	Acute gonococcal cervicitis		Approved	[5]
Cidofovir	DMA13GD	Cytomegalovirus infection	1D82	Approved	[7]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[8]
Famotidine	DMRL3AB	Gastric ulcer	DA60	Approved	[9]
FLUORESCEIN	DMQTFAO	Ocular disease	1F00.1Z	Approved	[10]
Furosemide	DMMQ8ZG	Congestive heart failure	BD10	Approved	[11]
Ganciclovir	DM1MBYQ	Cytomegalovirus infection	1D82	Approved	[1]
MCI-186	DM8ZHP1	Amyotrophic lateral sclerosis	8B60.0	Approved	[12]
Meropenem	DM62UHC	Bacterial infection	1A00-1C4Z	Approved	[13]
Methotrexate	DM2TEOL	Anterior urethra cancer		Approved	[14]
Mycophenolic acid	DMRBMAU	Crohn disease	DD70	Approved	[15]
Olmesartan medoxomil	DMWBHRY	High blood pressure	BA00	Approved	[16]
Oseltamivir	DMGO72P	Influenza	1E30-1E32	Approved	[5]
Tenofovir	DM1IS6U	Chronic hepatitis B virus infection		Approved	[17]
Trifluridine	DMG2YBD	Herpetic keratitis	1F00.10	Approved	[18]
Zalcitabine	DMH7MUV	Human immunodeficiency virus infection	1C62	Approved	[19]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[1]

2 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dimesna	DMU4T9Y	Diabetic nephropathy	GB61.Z	Phase 3	[20]
PGF2alpha	DM4XAU7	Solid tumour/cancer	2A00-2F9Z	Clinical trial	[8]

5 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
3R14S-OCHRATOXIN A	DM2KEW6	Discovery agent	N.A.	Investigative	[21]
6-Carboxyfluorescein	DMWTMDH	N. A.	N. A.	Investigative	[22]
AMINOHIPPURIC ACID	DMUN54G	Discovery agent	N.A.	Investigative	[23]
GLUTARATE	DMPUFDS	Discovery agent	N.A.	Investigative	[22]
uric acid	DMA1MKT	Discovery agent	N.A.	Investigative	[24]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	6.78E-02	6.55E-02	3.26E-01
Adrenocortical carcinoma	2D11.Z	Kidney	1.65E-01	-8.24E-02	-4.28E-01
Alopecia	ED70	Skin from scalp	1.90E-01	-8.54E-02	-4.45E-01
Alzheimer's disease	8A20	Entorhinal cortex	7.18E-01	-4.56E-02	-1.42E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	8.36E-01	1.27E-02	1.21E-01
Aortic stenosis	BB70	Calcified aortic valve	9.18E-01	-3.08E-02	-9.72E-02
Apnea	7A40	Hyperplastic tonsil	6.21E-01	-3.59E-02	-2.24E-01
Arthropathy	FA00-FA5Z	Peripheral blood	9.02E-01	3.20E-02	2.61E-01
Asthma	CA23	Nasal and bronchial airway	3.92E-02	-7.64E-02	-1.81E-01
Atopic dermatitis	EA80	Skin	1.20E-01	-3.21E-03	-2.74E-02
Autism	6A02	Whole blood	6.81E-01	-4.41E-02	-1.51E-01
Autoimmune uveitis	9A96	Peripheral monocyte	4.17E-04	-2.81E-01	-1.69E+00
Autosomal dominant monocytopenia	4B04	Whole blood	6.32E-02	-9.60E-02	-5.76E-01
Bacterial infection of gingival	1C1H	Gingival tissue	3.58E-01	3.69E-02	1.61E-01
Batten disease	5C56.1	Whole blood	2.01E-01	2.77E-02	4.74E-01
Behcet's disease	4A62	Peripheral blood	7.86E-01	2.62E-02	1.62E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	5.62E-01	1.94E-02	1.14E-01
Bladder cancer	2C94	Bladder tissue	2.36E-02	2.88E-01	1.15E+00
Breast cancer	2C60-2C6Z	Breast tissue	1.98E-01	-2.53E-02	-8.81E-02
Cardioembolic stroke	8B11.20	Whole blood	7.85E-01	6.21E-02	4.55E-01
Cervical cancer	2C77	Cervical tissue	3.33E-02	7.55E-02	4.06E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	8.02E-01	-2.78E-02	-8.32E-02
Chronic hepatitis C	1E51.1	Whole blood	7.47E-01	6.26E-02	4.07E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	9.06E-01	2.31E-03	1.26E-02
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.25E-04	1.88E-01	8.77E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	9.06E-01	-4.78E-02	-3.55E-01
Colon cancer	2B90	Colon tissue	7.46E-06	-1.05E-01	-4.80E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	1.99E-01	-4.24E-01	-1.39E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	6.09E-01	-1.69E-01	-1.04E+00
Endometriosis	GA10	Endometrium tissue	7.57E-01	6.84E-02	1.89E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.29E-01	9.68E-02	7.68E-01
Familial hypercholesterolemia	5C80.00	Whole blood	3.38E-01	8.25E-02	3.56E-01
Gastric cancer	2B72	Gastric tissue	5.11E-01	-1.56E-01	-6.46E-01
Glioblastopma	2A00.00	Nervous tissue	8.96E-37	-3.14E-01	-7.84E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	8.75E-06	-7.38E-01	-2.89E+00
Head and neck cancer	2D42	Head and neck tissue	9.41E-01	6.27E-03	2.92E-02
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.66E-01	-1.05E-01	-7.10E-01
Huntington's disease	8A01.10	Whole blood	1.51E-01	5.11E-02	4.15E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	3.55E-02	-9.29E-02	-9.37E-01
Immunodeficiency	4A00-4A20	Peripheral blood	8.30E-01	-3.56E-03	-2.65E-02
Influenza	1.00E+30	Whole blood	7.91E-02	3.59E-01	1.52E+00
Interstitial cystitis	GC00.3	Bladder tissue	8.83E-01	6.94E-02	5.81E-01
Intracranial aneurysm	8B01.0	Intracranial artery	4.19E-01	5.15E-02	2.60E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.16E-01	1.95E-02	9.87E-02
Ischemic stroke	8B11	Peripheral blood	7.93E-01	-4.59E-02	-3.13E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	3.43E-02	3.72E-02	1.29E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	5.80E-01	4.39E-02	1.78E-01
Lateral sclerosis	8B60.4	Skin	4.64E-01	-3.69E-02	-2.34E-01
Liver cancer	2C12.0	Liver tissue	1.27E-03	-1.28E-01	-4.10E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.52E-01	-1.23E-01	-6.94E-01
Lung cancer	2C25	Lung tissue	7.69E-06	-7.69E-02	-3.30E-01
Lupus erythematosus	4A40	Whole blood	9.50E-02	-9.92E-03	-3.58E-02
Major depressive disorder	6A70-6A7Z	Whole blood	1.33E-01	2.14E-02	1.04E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	4.75E-01	5.68E-02	3.29E-01
Melanoma	2C30	Skin	3.83E-02	-2.14E-01	-7.21E-01
Multiple myeloma	2A83.1	Bone marrow	9.16E-01	2.91E-02	2.11E-01
Multiple myeloma	2A83.1	Peripheral blood	1.92E-01	-1.38E-01	-6.64E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	1.56E-01	2.13E-01	1.12E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	5.63E-01	-7.45E-02	-3.88E-01
Myelofibrosis	2A20.2	Whole blood	4.70E-01	4.21E-02	2.96E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.27E-01	4.60E-02	1.66E-01
Myopathy	8C70.6	Muscle tissue	3.42E-04	-2.91E-01	-2.51E+00
Neonatal sepsis	KA60	Whole blood	2.31E-01	2.76E-02	1.03E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.77E-04	-4.81E-01	-1.65E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.35E-01	-1.75E-01	-7.91E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	2.07E-01	-1.99E-03	-1.72E-02
Olive pollen allergy	CA08.00	Peripheral blood	1.19E-01	2.09E-01	1.52E+00
Oral cancer	2B6E	Oral tissue	2.35E-13	-4.50E-01	-2.29E+00
Osteoarthritis	FA00-FA0Z	Synovial tissue	3.67E-02	-3.37E-01	-1.01E+00
Osteoporosis	FB83.1	Bone marrow	6.98E-01	1.17E-01	3.99E-01
Ovarian cancer	2C73	Ovarian tissue	2.24E-02	-2.07E-01	-1.09E+00
Pancreatic cancer	2C10	Pancreas	2.64E-03	-2.75E-01	-9.44E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	1.74E-01	-1.44E-01	-3.17E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	5.51E-03	-1.39E-01	-9.08E-01
Pituitary cancer	2D12	Pituitary tissue	1.59E-01	1.16E-01	4.85E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	6.95E-01	3.50E-02	1.47E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	8.60E-01	-1.71E-03	-5.22E-03
Polycythemia vera	2A20.4	Whole blood	1.07E-04	1.09E-01	7.69E-01
Pompe disease	5C51.3	Biceps muscle	9.41E-01	2.28E-02	1.41E-01
Preterm birth	KA21.4Z	Myometrium	5.19E-01	4.81E-03	3.21E-02
Prostate cancer	2C82	Prostate	7.93E-02	2.82E-01	5.41E-01
Psoriasis	EA90	Skin	4.87E-03	6.86E-02	2.52E-01
Rectal cancer	2B92	Rectal colon tissue	5.95E-02	-3.18E-01	-1.45E+00
Renal cancer	2C90-2C91	Kidney	2.33E-03	-3.20E+00	-1.79E+00
Retinoblastoma	2D02.2	Uvea	2.68E-03	-2.51E-01	-2.14E+00
Rheumatoid arthritis	FA20	Synovial tissue	2.48E-03	-7.14E-01	-2.31E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.29E-01	-4.29E-02	-3.50E-01
Schizophrenia	6A20	Prefrontal cortex	7.38E-01	2.36E-02	8.89E-02
Schizophrenia	6A20	Superior temporal cortex	3.37E-01	3.39E-02	2.57E-01
Scleroderma	4A42.Z	Whole blood	4.83E-01	-3.78E-02	-3.47E-01
Seizure	8A60-8A6Z	Whole blood	5.95E-01	-1.21E-01	-6.15E-01
Sensitive skin	EK0Z	Skin	2.82E-01	1.47E-01	8.68E-01
Sepsis with septic shock	1G41	Whole blood	7.43E-01	2.44E-02	7.62E-02
Shwachman-Diamond syndrome	3A70.0	Bone marrow	7.58E-01	-2.03E-02	-8.76E-02
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	2.55E-01	4.22E-02	1.58E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.19E-02	1.26E-01	1.48E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	5.88E-01	-1.89E-01	-7.88E-01
Skin cancer	2C30-2C3Z	Skin	7.22E-01	-6.49E-02	-2.24E-01
Thrombocythemia	3B63	Whole blood	1.52E-01	7.70E-02	5.84E-01
Thrombocytopenia	3B64	Whole blood	8.59E-01	5.06E-02	3.05E-01
Thyroid cancer	2D10	Thyroid	1.11E-04	9.36E-02	4.05E-01
Tibial muscular dystrophy	8C75	Muscle tissue	2.48E-06	-4.59E-01	-1.72E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.76E-01	-1.04E-01	-1.17E+00
Type 2 diabetes	5A11	Liver tissue	7.13E-01	4.13E-03	1.84E-02
Ureter cancer	2C92	Urothelium	7.27E-01	8.87E-02	3.15E-01
Uterine cancer	2C78	Endometrium tissue	2.68E-05	1.52E-01	5.59E-01
Vitiligo	ED63.0	Skin	2.19E-01	-1.16E-01	-9.52E-01

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Aciclovir	Approved	Human embryonic kidney cells (HEK293)-OAT1	Km = 839.0 microM	[25]
Aciclovir	Approved	Proximal tubule (S2) cells-OAT1	Km = 342.0 microM	[1]
Cidofovir	Approved	Chinese hamster ovary (CHO) cells-OAT1	Km = 30.0 microM	[26]
Cidofovir	Approved	Chinese hamster ovary (CHO) cells-OAT1	Km = 58.0 microM	[2]
Cidofovir	Approved	Oocytes-OAT1	Km = 46.0 microM	[27]
Dinoprostone	Approved	Proximal tubule (S2) cells-OAT1	Km = 0.97 microM	[8]
Ganciclovir	Approved	Proximal tubule (S2) cells-OAT1	Km = 896.0 microM	[1]
MCI-186	Approved	Human embryonic kidney cells (HEK293)-OAT1	Km = 10.8 microM	[12]
Methotrexate	Approved	Oocytes-OAT1	Km = 724.0 microM	[28]
Methotrexate	Approved	Proximal tubule (S2) cells-OAT1	Km = 554.0 microM	[29]
Olmesartan medoxomil	Approved	Human embryonic kidney cells (HEK293)-OAT1	Km = 0.0683 microM	[16]
Tenofovir	Approved	Chinese hamster ovary (CHO) cells-OAT1	Km = 33.8 microM	[17]
Zidovudine	Approved	Proximal tubule (S2) cells-OAT1	Km = 45.9 microM	[1]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Dimesna	Phase 3	Human cervical cancer cell line (Hela)-OAT1	Km = 636.0 microM	[20]
PGF2alpha	Clinical trial	Proximal tubule (S2) cells-OAT1	Km = 0.575 microM	[8]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
3R14S-OCHRATOXIN A	Investigative	Proximal tubule (S2) cells-OAT1	Km = 0.42 microM	[21]
AMINOHIPPURIC ACID	Investigative	Chinese hamster ovary (CHO) cells-OAT1	Km = 15.4 microM	[2]
AMINOHIPPURIC ACID	Investigative	Human cervical cancer cell line (Hela)-OAT1	Km = 5.0 microM	[30]
AMINOHIPPURIC ACID	Investigative	Human embryonic kidney cells (HEK293)-OAT1	Km = 20.0 microM	[25]
AMINOHIPPURIC ACID	Investigative	Human embryonic kidney cells (HEK293)-OAT1	Km = 28.0 microM	[31]
AMINOHIPPURIC ACID	Investigative	Madin-Darby canine kidney (MDCK) cells-OAT1	Km = 8.5 microM	[32]
AMINOHIPPURIC ACID	Investigative	Monkey kidney fibroblast-like cell (COS)7-OAT1	Km = 8.9 microM	[33]
AMINOHIPPURIC ACID	Investigative	OK cells-OAT1	Km = 22.0 microM	[34]
AMINOHIPPURIC ACID	Investigative	Oocytes-OAT1	Km = 3.9 microM	[35]
AMINOHIPPURIC ACID	Investigative	Oocytes-OAT1	Km = 4.0 microM	[27]
AMINOHIPPURIC ACID	Investigative	Oocytes-OAT1	Km = 9.3 microM	[36]
AMINOHIPPURIC ACID	Investigative	Proximal tubule (S2) cells-OAT1	Km = 20.1 microM	[37]
GLUTARATE	Investigative	Chinese hamster ovary (CHO) cells-OAT1	Km = 10.7 microM	[22]
uric acid	Investigative	Human embryonic kidney cells (HEK293)-OAT1	Km = 197.6 microM	[24]
uric acid	Investigative	Proximal tubule (S2) cells-OAT1	Km = 947.0 microM	[38]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Organic anion transporter 1 DTT Info

References

• [1] Human organic anion transporters and human organic cation transporters mediate renal antiviral transport. J Pharmacol Exp Ther. 2002 Mar;300(3):918-24.
• [2] Cytotoxicity of antiviral nucleotides adefovir and cidofovir is induced by the expression of human renal organic anion transporter 1. J Am Soc Nephrol. 2000 Mar;11(3):383-93.
• [3] Prostaglandin transporter (OATP2A1/SLCO2A1) contributes to local disposition of eicosapentaenoic acid-derived PGE3. Prostaglandins Other Lipid Mediat. 2016 Jan;122:10-7.
• [4] The anti-influenza drug oseltamivir exhibits low potential to induce pharmacokinetic drug interactions via renal secretion-correlation of in vivo and in vitro studies. Drug Metab Dispos. 2002 Jan;30(1):13-9.
• [5] FDA Drug Development and Drug Interactions
• [6] Expression levels of renal organic anion transporters (OATs) and their correlation with anionic drug excretion in patients with renal diseases. Pharm Res. 2004 Jan;21(1):61-7.
• [7] Renal transport of adefovir, cidofovir, and tenofovir by SLC22A family members (hOAT1, hOAT3, and hOCT2). Pharm Res. 2007 Apr;24(4):811-5.
• [8] Human organic anion transporters and human organic cation transporters mediate renal transport of prostaglandins. J Pharmacol Exp Ther. 2002 Apr;301(1):293-8.
• [9] Different transport properties between famotidine and cimetidine by human renal organic ion transporters (SLC22A). Eur J Pharmacol. 2004 Oct 25;503(1-3):25-30.
• [10] Apical expression or expression in a non polarized cell of hOAT1 inverses regulation by epidermal growth factor (EGF) as compared to basolateral hOAT1. Cell Physiol Biochem. 2004;14(3):177-86.
• [11] Interactions of human organic anion transporters with diuretics. J Pharmacol Exp Ther. 2004 Mar;308(3):1021-9.
• [12] Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate. Drug Metab Dispos. 2007 Aug;35(8):1429-34.
• [13] Characterization of CS-023 (RO4908463), a novel parenteral carbapenem antibiotic, and meropenem as substrates of human renal transporters. Drug Metab Pharmacokinet. 2007 Feb 25;22(1):41-7.
• [14] Transport of aminopterin by human organic anion transporters hOAT1 and hOAT3: Comparison with methotrexate. Drug Metab Pharmacokinet. 2010;25(2):163-9.
• [15] Interaction and transport characteristics of mycophenolic acid and its glucuronide via human organic anion transporters hOAT1 and hOAT3. Biochem Pharmacol. 2007 Jun 30;74(1):161-8.
• [16] Multiple human isoforms of drug transporters contribute to the hepatic and renal transport of olmesartan, a selective antagonist of the angiotensin II AT1-receptor. Drug Metab Dispos. 2007 Dec;35(12):2166-76.
• [17] Human renal organic anion transporter 1 (hOAT1) and its role in the nephrotoxicity of antiviral nucleotide analogs. Nucleosides Nucleotides Nucleic Acids. 2001 Apr-Jul;20(4-7):641-8.
• [18] Rat multispecific organic anion transporter 1 (rOAT1) transports zidovudine, acyclovir, and other antiviral nucleoside analogs. J Pharmacol Exp Ther. 2000 Sep;294(3):844-9.
• [19] Interaction of zalcitabine with human organic anion transporter 1. Pharmazie. 2006 May;61(5):491-2.
• [20] In vitro and in vivo assessment of renal drug transporters in the disposition of mesna and dimesna. J Clin Pharmacol. 2012 Apr;52(4):530-42.
• [21] Characterization of ochratoxin A transport by human organic anion transporters. Life Sci. 2001 Sep 21;69(18):2123-35.
• [22] Fluorescence-based assay for the interaction of small molecules with the human renal organic anion transporter 1. Anal Biochem. 2000 Jul 15;283(1):49-55.
• [23] Interactions of human organic anion transporter 1 (hOAT1) with substances associated with forensic toxicology. Leg Med (Tokyo). 2011 Jul;13(4):180-5.
• [24] Involvement of uric acid transporters in alteration of serum uric acid level by angiotensin II receptor blockers. Pharm Res. 2008 Mar;25(3):639-46.
• [25] Expression of organic anion transporter 2 in the human kidney and its potential role in the tubular secretion of guanine-containing antiviral drugs. Drug Metab Dispos. 2012 Mar;40(3):617-24.
• [26] Transport of the dipeptidyl peptidase-4 inhibitor sitagliptin by human organic anion transporter 3, organic anion transporting polypeptide 4C1, and multidrug resistance P-glycoprotein. J Pharmacol Exp Ther. 2007 May;321(2):673-83.
• [27] The antiviral nucleotide analogs cidofovir and adefovir are novel substrates for human and rat renal organic anion transporter 1. Mol Pharmacol. 1999 Sep;56(3):570-80.
• [28] Methotrexate-loxoprofen interaction: involvement of human organic anion transporters hOAT1 and hOAT3. Drug Metab Pharmacokinet. 2004 Oct;19(5):369-74.
• [29] Characterization of methotrexate transport and its drug interactions with human organic anion transporters. J Pharmacol Exp Ther. 2002 Aug;302(2):666-71.
• [30] Cloning of the human kidney PAH transporter: narrow substrate specificity and regulation by protein kinase C. Am J Physiol. 1999 Feb;276(2):F295-303.
• [31] Human organic anion transporter hOAT3 is a potent transporter of cephalosporin antibiotics, in comparison with hOAT1. Biochem Pharmacol. 2005 Oct 1;70(7):1104-13.
• [32] Stoichiometry of organic anion/dicarboxylate exchange in membrane vesicles from rat renal cortex and hOAT1-expressing cells. Am J Physiol Renal Physiol. 2003 Oct;285(4):F775-83.
• [33] Interaction of cysteine conjugates with human and rabbit organic anion transporter 1. J Pharmacol Exp Ther. 2003 Feb;304(2):560-6.
• [34] Uraemic toxins induce proximal tubular injury via organic anion transporter 1-mediated uptake. Br J Pharmacol. 2002 Jan;135(2):555-63.
• [35] Interaction of 2,3-dimercapto-1-propane sulfonate with the human organic anion transporter hOAT1. J Pharmacol Exp Ther. 2001 Nov;299(2):741-7.
• [36] Molecular cloning and functional expression of a multispecific organic anion transporter from human kidney. Am J Physiol. 1999 Jan;276(1):F122-8.
• [37] Characterization of organic anion transport inhibitors using cells stably expressing human organic anion transporters. Eur J Pharmacol. 2001 May 11;419(2-3):113-20.
• [38] Urate transport via human PAH transporter hOAT1 and its gene structure. Kidney Int. 2003 Jan;63(1):143-55.