Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT51DEV)
| DTT Name | Interleukin 1 receptor type 2 (IL1R2) | ||||
|---|---|---|---|---|---|
| Synonyms |
Interleukin-1 receptor type II; Interleukin-1 receptor type 2; Interleukin-1 receptor beta; Interleukin 1 receptor type II; IL1RB; IL-1RT2; IL-1RT-2; IL-1R-beta; IL-1R-2; IL-1 type II receptor; CDw121b; CD121b; CD121 antigen-like family member B; Antigen CDw121b
|
||||
| Gene Name | IL1R2 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Cytokine receptor
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK |
||||
| Function |
Reduces IL1B activities. Serves as a decoy receptor by competetive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1RAP after binding to IL1B. IL1R2 (membrane and secreted forms) preferentially binds IL1B and poorly IL1A and IL1RN. The secreted IL1R2 recruits secreted IL1RAP with high affinity; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Non-signaling receptor for IL1A, IL1B and IL1RN.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
|
3 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
| 1 | WO patent application no. 2013,0077,63, Modulators of the nlrp3 inflammasome il-1ss pathway for the prevention and treatment of acne. | ||||
|---|---|---|---|---|---|
| 2 | Clinical pipeline report, company report or official report of Amgen (2009). | ||||
| 3 | Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83. | ||||
| 4 | SDZ MRL 953, a lipid A analog as selective cytokine inducer. Prog Clin Biol Res. 1995;392:549-65. | ||||
