Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBW580)

DTT Name	TAX transcriptionally-activated glycoprotein 1 (OX40)
Synonyms	Tumor necrosis factor ligand superfamily member 4; TNFSF4; OX40L; Glycoprotein Gp34; CD252
Gene Name	TNFSF4
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine: tumor necrosis factor
UniProt ID	TNFL4_HUMAN
TTD ID	T55860
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF CVL
Function	Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 )
Reactome Pathway	TNFs bind their physiological receptors (R-HSA-5669034 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMG 386	DMQJXL4	Breast cancer	2C60-2C65	Phase 3	[1]
Amlitelimab	DMKR3BQ	Asthma	CA23	Phase 2	[2]
RG7888	DM2SWI8	Solid tumour/cancer	2A00-2F9Z	Phase 2	[3]
MEDI6383	DM1YSMD	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]
mRNA-2416	DMFTAWU	Lymphoma	2A80-2A86	Phase 1	[5]
mRNA-2752	DMUKBI2	Solid tumour/cancer	2A00-2F9Z	Phase 1	[6]
SAR442970	DM3DHWE	Inflammation	1A00-CA43.1	Phase 1	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Clinical Trial Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	9.04E-01	-0.12	-0.21
------------------------------------------------------------------------------------

References

1	Clinical targeting of the TNF and TNFR superfamilies.Nat Rev Drug Discov.2013 Feb;12(2):147-68.
2	OX40-OX40L Inhibition for the Treatment of Atopic Dermatitis-Focus on Rocatinlimab and Amlitelimab. Pharmaceutics. 2022 Dec 8;14(12):2753.
3	Anti-tumor efficacy and biomarker evaluation of agonistic anti-OX40 antibodies in preclinical models. J Immunother Cancer. 2014; 2(Suppl 3): P105.
4	J Clin Oncol 33, 2015 (suppl; abstr 3056).
5	Clinical pipeline report, company report or official report of Moderna Therapeutics.
6	Clinical pipeline report, company report or official report of Moderna Therapeutics.
7	Clinical pipeline report, company report or official report of Sanofi