Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTU6BFZ)

• DTT Name: Candida Thymidylate synthase (Candi TMP1)
• Synonyms: Tsase of Candida albicans; TS of Candida albicans; TMP1; Human recombinant thymidylate synthase; HrTS
• Gene Name: Candi TMP1
• DTT Type: Successful target; [1]
• BioChemical Class: Methyltransferase
• UniProt ID: TYSY_CANAL
• TTD ID: T52227
• EC Number: EC 2.1.1.45
• Sequence:
  MTVSPNTAEQAYLDLCKRIIDEGEHRPDRTGTGTKSLFAPPQLRFDLSNDTFPLLTTKKV
  FSKGIIHELLWFVAGSTDAKILSEKGVKIWEGNGSREFLDKLGLTHRREGDLGPVYGFQW
  RHFGAEYKDCDSDYTGQGFDQLQDVIKKLKTNPYDRRIIMSAWNPPDFAKMALPPCHVFC
  QFYVNFPTSSPDPNNPKQAKTAKPKLSCLLYQRSCDMGLGVPFNIASYALLTKMIAHVVD
  MDCGEFIHTLGDAHVYLDHIDALKEQFERIPKQFPKLVIKEERKNEIKSIDDFKFEDFEI
  VGYEPYPPIKMKMSV
• Function: Contributes to thede novo mitochondrial thymidylate biosynthesis pathway.
• KEGG Pathway:
  Pyrimidine metabolism (hsa00240)
  One carbon pool by folate (hsa00670)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Pyrimidine biosynthesis (R-HSA-500753)
  G1/S-Specific Transcription (R-HSA-69205)
  E2F mediated regulation of DNA replication (R-HSA-113510)

Molecular Interaction Atlas (MIA) of This DTT

8 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Capecitabine	DMTS85L	Adenocarcinoma	2D40	Approved	[2]
Ciprofloxacin XR	DM2NLS9	Acute gonococcal cervicitis		Approved	[3]
Floxuridine	DM04LR2	Colorectal cancer	2B91.Z	Approved	[4]
Flucytosine	DM13VTW	Cryptococcal meningitis		Approved	[5]
Fluorouracil	DMUM7HZ	Adenocarcinoma	2D40	Approved	[6]
Pemetrexed	DMMX2E6	Central nervous system lymphoma	2B33.5	Approved	[1]
Raltitrexed	DMT9K8G	Rectal adenocarcinoma	2B92	Approved	[7]
Trifluridine	DMG2YBD	Herpetic keratitis	1F00.10	Approved	[8]

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nolatrexed	DMOF0CA	Solid tumour/cancer	2A00-2F9Z	Phase 3	[9]
Plevitrexed	DM7Y60I	Gastric adenocarcinoma	2B72	Phase 2	[10]
Plevitrexed (R)-isomer	DMTL39C	Gastric adenocarcinoma	2B72	Phase 2	[10]
UFT/leucovorin calcium	DMWDJ15	Colorectal cancer	2B91.Z	Phase 2	[11]
NB1011	DM5O4GR	Breast cancer	2C60-2C65	Phase 1/2	[12]
DFP-11207	DMY6QFH	Solid tumour/cancer	2A00-2F9Z	Phase 1	[13]

7 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
EMITEFUR	DMKQI7S	Solid tumour/cancer	2A00-2F9Z	Discontinued in Preregistration	[14]
Galocitabine	DMNSE2I	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 3	[15]
FO-152	DM3PXLZ	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[16]
TT-62	DMWXOJN	Virus infection	1A24-1D9Z	Discontinued in Phase 2	[17]
AG-331	DMCEM0L	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[18]
DMPDDF	DMLBS83	Solid tumour/cancer	2A00-2F9Z	Terminated	[19]
Fosfluridine tidoxil	DMSYLIF	Keratosis	ED56	Terminated	[20]

33 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(6s)-5,6,7,8-Tetrahydrofolate	DMRAC6T	Discovery agent	N.A.	Investigative	[21]
1,3-propanediphosphonic acid	DMVBI2C	Discovery agent	N.A.	Investigative	[22]
1,4-Dithiothreitol	DMIFOXE	Discovery agent	N.A.	Investigative	[21]
10-Propargyl-5,8-Dideazafolic Acid	DMR3A5N	N. A.	N. A.	Investigative	[21]
2'-5'dideoxyuridine	DM6P3Z8	Discovery agent	N.A.	Investigative	[23]
2'-Deoxycytidine-5'-Monophosphate	DMG7CAU	Discovery agent	N.A.	Investigative	[21]
2'-Deoxyguanosine-5'-Monophosphate	DMY9FDT	Discovery agent	N.A.	Investigative	[21]
2'-Deoxyuridine	DM1HMWA	Discovery agent	N.A.	Investigative	[21]
2'-deoxyuridylic acid	DMPV1LU	Discovery agent	N.A.	Investigative	[21]
2-bromophenol	DM6JDIY	Discovery agent	N.A.	Investigative	[23]
2-Sulfhydryl-Ethanol	DMJBO3D	Discovery agent	N.A.	Investigative	[21]
3-Amino-5,6-dihydro-2H-benzo[f]quinazolin-1-one	DMP2K1A	Discovery agent	N.A.	Investigative	[24]
3-DIPHENOL-6-NITRO-3H-BENZO[DE]ISOCHROMEN-1-ONE	DMVHQB8	Discovery agent	N.A.	Investigative	[25]
3-Methyl-2H-benzo[f]quinazolin-1-one	DMFC0H5	Discovery agent	N.A.	Investigative	[24]
4-CHLORO-3',3''-DIBROMOPHENOL-1,8-NAPHTHALEIN	DMIYVJX	Discovery agent	N.A.	Investigative	[23]
5,10-Methylene-6-Hydrofolic Acid	DMAQDK9	Discovery agent	N.A.	Investigative	[21]
5-Fluoro-2'-Deoxyuridine-5'-Monophosphate	DME1AGO	Discovery agent	N.A.	Investigative	[21]
6-ETHYL-5-PHENYLPYRIMIDINE-2,4-DIAMINE	DM9OD7U	Discovery agent	N.A.	Investigative	[25]
Ly231514 Tetra Glu	DM5VWCI	Discovery agent	N.A.	Investigative	[21]
LY341770	DMS7KW8	Discovery agent	N.A.	Investigative	[21]
Methionine Sulfoxide	DMKE18W	Discovery agent	N.A.	Investigative	[25]
N,O-Didansyl-L-Tyrosine	DM7FT8D	Discovery agent	N.A.	Investigative	[21]
N-Carboxymethionine	DMX80JF	Discovery agent	N.A.	Investigative	[21]
N-[Tosyl-D-Prolinyl]Amino-Ethanethiol	DMN493F	Discovery agent	N.A.	Investigative	[21]
OVI-117	DMAV9PS	Solid tumour/cancer	2A00-2F9Z	Investigative	[16]
PREMETREXED	DMVOGT4	Discovery agent	N.A.	Investigative	[26]
S,S-(2-Hydroxyethyl)Thiocysteine	DMLPAD8	Discovery agent	N.A.	Investigative	[21]
Sp-722	DMV1W4M	Discovery agent	N.A.	Investigative	[21]
Sp-876	DMJZKEH	Discovery agent	N.A.	Investigative	[21]
Thymidine-5'-Phosphate	DMKM6NQ	Discovery agent	N.A.	Investigative	[21]
Tosyl-D-Proline	DMNC2A5	Discovery agent	N.A.	Investigative	[21]
Uridine-5'-Monophosphate	DMG1NM7	Discovery agent	N.A.	Investigative	[21]
ZD1604	DMLI8GZ	Discovery agent	N.A.	Investigative	[27]

References

• [1] Updated clinical information on multitargeted antifolates in lung cancer. Clin Lung Cancer. 2009 Mar;10 Suppl 1:S35-40.
• [2] UGT1A7 and UGT1A9 polymorphisms predict response and toxicity in colorectal cancer patients treated with capecitabine/irinotecan. Clin Cancer Res. 2005 Feb 1;11(3):1226-36.
• [3] Loss of folylpoly-gamma-glutamate synthetase activity is a dominant mechanism of resistance to polyglutamylation-dependent novel antifolates in multiple human leukemia sublines. Int J Cancer. 2003 Feb 20;103(5):587-99.
• [4] Antisense down-regulation of thymidylate synthase to suppress growth and enhance cytotoxicity of 5-FUdR, 5-FU and Tomudex in HeLa cells. Br J Pharmacol. 1999 Aug;127(8):1777-86.
• [5] Antifungal agents: mode of action in yeast cells. Rev Esp Quimioter. 2006 Jun;19(2):130-9.
• [6] The efficacy of the combination therapy of 5-fluorouracil, cisplatin and leucovorin for hepatocellular carcinoma and its predictable factors. Cancer Chemother Pharmacol. 2004 Apr;53(4):296-304.
• [7] DNA damage and homologous recombination signaling induced by thymidylate deprivation. Biochem Pharmacol. 2008 Oct 15;76(8):987-96.
• [8] Trifluorothymidine induces cell death independently of p53. Nucleosides Nucleotides Nucleic Acids. 2008 Jun;27(6):699-703.
• [9] A phase I study of the lipophilic thymidylate synthase inhibitor Thymitaq (nolatrexed dihydrochloride) given by 10-day oral administration. Br J Cancer. 1999 Feb;79(5-6):915-20.
• [10] Cooperative inhibition of human thymidylate synthase by mixtures of active site binding and allosteric inhibitors. Biochemistry. 2007 Mar 13;46(10):2823-30.
• [11] Leucovorin enhancement of the effects of the fluoropyrimidines on thymidylate synthase. Cancer. 1989 Mar 15;63(6 Suppl):1008-12.
• [12] Kinetic properties of human thymidylate synthase, an anticancer drug target. Biochem Biophys Res Commun. 2003 Jul 25;307(2):297-300.
• [13] National Cancer Institute Drug Dictionary (drug id 762603).
• [14] Antitumor activity of fluoropyrimidines and thymidylate synthetase inhibition. Jpn J Cancer Res. 1991 Apr;82(4):476-82.
• [15] The role of thymidylate synthase in cellular regulation. Adv Enzyme Regul. 1996;36:143-63.
• [16] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2642).
• [17] TECHNOLOGY, PRODUCTS, MARKETS AND SERVICE OPPORTUNITIES. Future Oncology. AUGUST 1995. VOLUME 1, NUMBER 4.
• [18] Phase I trial of the thymidylate synthase inhibitor AG331 as a 5-day continuous infusion. Clin Cancer Res. 1996 Oct;2(10):1685-92.
• [19] Folate analogues. 32. Synthesis and biological evaluation of 2-desamino-2-methyl-N10-propargyl-5,8-dideazafolic acid and related compounds. J Med Chem. 1989 Jun;32(6):1284-9.
• [20] Selective protection by uridine of growth inhibition by 5-fluorouracil (5FU) mediated by 5FU incorporation into RNA, but not the thymidylate synthase mediated growth inhibition by 5FU-leucovorin. Nucleosides Nucleotides Nucleic Acids. 2008 Jun;27(6):733-9.
• [21] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [22] Novel approaches for targeting thymidylate synthase to overcome the resistance and toxicity of anticancer drugs. J Med Chem. 2010 Sep 23;53(18):6539-49.
• [23] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
• [24] Benzoquinazoline inhibitors of thymidylate synthase: enzyme inhibitory activity and cytotoxicity of some sulfonamidobenzoylglutamate and related de... J Med Chem. 1993 Oct 29;36(22):3464-71.
• [25] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [26] Dual inhibitors of thymidylate synthase and dihydrofolate reductase as antitumor agents: design, synthesis, and biological evaluation of classical ... J Med Chem. 2006 Feb 9;49(3):1055-65.
• [27] Acquisition of resistance to anticancer agents by overproduction of target enzymes. Nippon Rinsho. 1997 May;55(5):1030-7.