Details of the Drug-Related molecule(s) Interaction Atlas

General Information of DTT (ID: TTVIMDE)

• DTT Name: Glucagon-like peptide 1 receptor (GLP1R) DTT Info
• Gene Name: GLP1R

Molecule-Related Drug & Molecule List

8 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Albiglutide	DM1JEGF	Type-2 diabetes	5A11	Approved	[1]
Dulaglutide	DMYXBV3	Type-2 diabetes	5A11	Approved	[2]
Exenatide	DMYHBKN	Inflammation	1A00-CA43.1	Approved	[3]
Liraglutide	DM3FXPS	Non-insulin dependent diabetes	5A11	Approved	[4]
Lixisenatide	DM0QJDC	Type-2 diabetes	5A11	Approved	[1]
Pramlintide	DM0EZ9Q	Type-1/2 diabetes	5A10-5A11	Approved	[4]
Semaglutide	DMAGFOD	Type-2 diabetes	5A11	Approved	[5]
Tirzepatide	DMQNMAT	Type 2 diabetes	5A11	Approved	[6]

46 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Efpeglenatide	DMKA2PI	Type-2 diabetes	5A11	Phase 3	[7]
GLP-1	DMR6YH3	Diabetic complication	5A2Y	Phase 3	[5]
GMA102	DMQIE7U	Obesity	5B81	Phase 3	[8]
GMA105	DM2XSG0	Obesity	5B81	Phase 3	[9]
LATIN T1D	DMAJM12	Type-1 diabetes	5A10	Phase 3	[5]
Orforglipron	DMC50VB	Obesity	5B81	Phase 3	[10]
PB-119	DM98PS6	Type 2 diabetes	5A11	Phase 3	[11]
Retatrutide	DM8WU0Q	Obesity	5B81	Phase 3	[12]
Taspoglutide	DMPYET9	Type-1 diabetes	5A10	Phase 3	[13]
Avexitide	DMQCXSG	Congenital hyperinsulinism	5A4Y	Phase 2	[14]
BI 456906	DM1NMGJ	Type 2 diabetes	5A11	Phase 2	[15]
Efinopegdutide	DMAN2V2	Non-alcoholic steatohepatitis	DB92.1	Phase 2	[16]
GTP-010	DMN6IDO	Dyspepsia	MD92	Phase 2	[17]
LY-2428757	DMKYMS2	Type-2 diabetes	5A11	Phase 2	[18]
LY2944876	DML6XWR	Diabetic complication	5A2Y	Phase 2	[19]
LY3437943	DMN37M6	Obesity	5B81	Phase 2	[20]
NLY01	DMI9OMV	Alzheimer disease	8A20	Phase 2	[21]
OI338GT	DMNEHY1	Type-1 diabetes	5A10	Phase 2	[22]
ORMD-0901	DMRIO6D	Type-2 diabetes	5A11	Phase 2	[23]
PB-1023	DMZCI04	Type-2 diabetes	5A11	Phase 2	[24]
PF-06882961	DM7EJ8S	Type 2 diabetes	5A11	Phase 2	[25]
PF-07081532	DM9WHMF	Obesity	5B81	Phase 2	[26]
RGT-075	DM1OBHA	Type 2 diabetes	5A11	Phase 2	[27]
Semorinemab	DMA17VD	Alzheimer disease	8A20	Phase 2	[28]
TT-401	DMRQ0SA	Type-2 diabetes	5A11	Phase 2	[29]
TTP-054	DMBNU1W	Type-2 diabetes	5A11	Phase 2	[30]
TTP273	DMZ6RG2	Type-2 diabetes	5A11	Phase 2	[7]
UNI-rE-4	DMOMI97	Type-2 diabetes	5A11	Phase 2	[31]
AZD0186	DM57J20	Type 2 diabetes	5A11	Phase 1	[32]
CM3.1-AC100	DMSJVX3	Diabetic complication	5A2Y	Phase 1	[5]
CNTO-3649	DM8L36X	Type-2 diabetes	5A11	Phase 1	[33]
CT 868	DMI7XMU	Type 2 diabetes	5A11	Phase 1	[34]
CT-388	DMWHBE5	Obesity	5B81	Phase 1	[16]
CVX 096	DMO23R0	Type-2 diabetes	5A11	Phase 1	[35]
DD01	DM0JKZ6	Obesity	5B81	Phase 1	[36]
GZR18	DM4YR7H	Type 2 diabetes	5A11	Phase 1	[37]
JNJ-54728518	DMBV3P8	Type-2 diabetes	5A11	Phase 1	[7]
LY3305677	DMJMLLW	Type 2 diabetes	5A11	Phase 1	[38]
NN-9926	DM1RBT8	Type-2 diabetes	5A11	Phase 1	[39]
OG987SC	DMZK1GW	Type-2 diabetes	5A11	Phase 1	[40]
Pemvidutide	DMVOG8A	Obesity	5B81	Phase 1	[41]
PF-4603629	DMKOE84	Type-2 diabetes	5A11	Phase 1	[31]
SAR425899	DM53IPE	Diabetic complication	5A2Y	Phase 1	[42]
SAR438335	DM7QO05	Type-2 diabetes	5A11	Phase 1	[7]
ZP2929	DMRVDUM	Type-1 diabetes	5A10	Phase 1	[43]
ZYOG1	DMZ6042	Diabetic complication	5A2Y	Phase 1	[44]

7 Discontinued Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CJC-1131	DMQD2LS	Type-1 diabetes	5A10	Discontinued in Phase 2	[45]
LY-307161	DMIS7DW	Type-2 diabetes	5A11	Discontinued in Phase 2	[46]
RG7685	DMPQC18	Type-2 diabetes	5A11	Discontinued in Phase 2	[47]
CM-GLP-1	DMH40I3	Brain injury	NA07.Z	Discontinued in Phase 1/2	[48]
LY-315902	DMKMIQ6	Type-2 diabetes	5A11	Discontinued in Phase 1	[49]
AZM-134	DMIWC64	Type-2 diabetes	5A11	Terminated	[51]
TH-0318	DMSRDGE	Diabetic complication	5A2Y	Terminated	[5]

1 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CIN-209	DMBK5CQ	Obesity	5B81	Preclinical	[50]

32 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AC-3174	DMNUE4H	Non-alcoholic steatohepatitis	DB92.1	Investigative	[52]
AMPE4L	DM64X25	Diabetic complication	5A2Y	Investigative	[52]
BETP	DM4MZQW	Discovery agent	N.A.	Investigative	[53]
CAM-2036	DM4FVDS	Non-insulin dependent diabetes	5A11	Investigative	[5]
CNTO-736	DMZ57O1	Non-insulin dependent diabetes	5A11	Investigative	[5]
C[Asp22-Lys26][Gly8]GLP-1(7-37)-NH2	DMISP20	Discovery agent	N.A.	Investigative	[54]
C[Cpa19-Lys26][Gly8]GLP-1(7-37)-NH2	DMYIJT1	Discovery agent	N.A.	Investigative	[54]
C[Glu18-Lys22][Gly8]GLP-1(7-37)-NH2	DMJR5UD	Discovery agent	N.A.	Investigative	[54]
C[Glu19-Lys23][Gly8]GLP-1(7-37)-NH2	DM6O4EZ	Discovery agent	N.A.	Investigative	[54]
C[Glu21-Lys25][Gly8]GLP-1(7-37)-NH2	DMA3ZRJ	Discovery agent	N.A.	Investigative	[54]
C[Glu21-Lys26][Gly8]GLP-1(7-37)-NH2	DMPK74W	Discovery agent	N.A.	Investigative	[54]
C[Glu22-Lys26][Gly8]GLP-1(7-37)-NH2	DM8I0CZ	Discovery agent	N.A.	Investigative	[54]
C[Glu22-Orn26][Gly8]GLP-1(7-37)-NH2	DMMA9GE	Discovery agent	N.A.	Investigative	[54]
C[Glu23-Lys27][Gly8]GLP-1(7-37)-NH2	DMWYN87	Discovery agent	N.A.	Investigative	[54]
C[Glu24-Lys28][Gly8]GLP-1(7-37)-NH2	DMKZXV3	Discovery agent	N.A.	Investigative	[54]
C[Glu26-Lys30][Gly8]GLP-1(7-37)-NH2	DMX2WCZ	Discovery agent	N.A.	Investigative	[54]
C[hGlu22-Lys26][Gly8]GLP-1(7-37)-NH2	DMTP5YZ	Discovery agent	N.A.	Investigative	[54]
F-18 exendin-4 derivative PET tracers	DMHETZN	Diabetic complication	5A2Y	Investigative	[52]
GLP-17-(7-36) derivative	DMBH18C	Discovery agent	N.A.	Investigative	[55]
Glu20-Lys24][Gly8][GLP-1(7-37)-NH2	DM0HWB1	Discovery agent	N.A.	Investigative	[54]
Glucagon-like peptide-1 analog	DMZLRY2	Non-insulin dependent diabetes	5A11	Investigative	[5]
GX-G6	DM1RY6Q	Diabetic complication	5A2Y	Investigative	[5]
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2	DMQCGRI	Discovery agent	N.A.	Investigative	[54]
HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR	DMN54LS	Discovery agent	N.A.	Investigative	[56]
PGC GLP-1	DM0NBKR	Diabetic complication	5A2Y	Investigative	[5]
SKL-18287	DMXS9V8	Non-insulin dependent diabetes	5A11	Investigative	[5]
SX-GLP1	DMT53U6	Non-insulin dependent diabetes	5A11	Investigative	[5]
ZP-3022	DMJ16AD	Diabetic complication	5A2Y	Investigative	[5]
[123I] iodobenzoyl 12-Ex4	DMHWNOS	Diabetic complication	5A2Y	Investigative	[52]
[Gly8, aib22]GLP-1(7-37)-NH2	DM9SP2U	Discovery agent	N.A.	Investigative	[54]
[Gly8,Glu22]GLP-1(7,37)-NH2	DMO8U3S	Discovery agent	N.A.	Investigative	[54]
[Gly8]GLP-1(7-37)-NH2	DM1SOT4	Discovery agent	N.A.	Investigative	[54]

References

• [1] GLP-1 receptor agonists for individualized treatment of type 2 diabetes mellitus.Nat Rev Endocrinol.2012 Dec;8(12):728-42.
• [2] 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
• [3] Improved glycemic control and reduction of cardiometabolic risk factors in subjects with type 2 diabetes and metabolic syndrome treated with exenatide in a clinical practice setting. Diabetes TechnolTher. 2009 Jun;11(6):353-9.
• [4] Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
• [5] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 249).
• [6] Dual GIP and GLP-1 Receptor Agonist Tirzepatide Improves Beta-cell Function and Insulin Sensitivity in Type 2 Diabetes. J Clin Endocrinol Metab. 2021 Jan 23;106(2):388-396.
• [7] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [8] Clinical pipeline report, company report or official report of Gmax Biopharm.
• [9] Clinical pipeline report, company report or official report of Gmax Biopharm.
• [10] Structural basis for GLP-1 receptor activation by LY3502970, an orally active nonpeptide agonist. Proc Natl Acad Sci U S A. 2020 Nov 24;117(47):29959-29967.
• [11] Clinical pipeline report, company report or official report of PegBio
• [12] Is retatrutide (LY3437943), a GLP-1, GIP, and glucagon receptor agonist a step forward in the treatment of diabetes and obesity? Expert Opin Investig Drugs. 2023 May;32(5):355-359.
• [13] Pharmacokinetic and pharmacodynamic properties of taspoglutide, a once-weekly, human GLP-1 analogue, after single-dose administration in patients with Type 2 diabetes. Diabet Med. 2009 Nov;26(11):1156-64.
• [14] PREVENT: A Randomized, Placebo-controlled Crossover Trial of Avexitide for Treatment of Postbariatric Hypoglycemia. J Clin Endocrinol Metab. 2021 Jul 13;106(8):e3235-e3248.
• [15] Clinical pipeline report, company report or official report of Boehringer Ingelheim.
• [16] Emerging glucagon-like peptide 1 receptor agonists for the treatment of obesity. Expert Opin Emerg Drugs. 2021 Sep;26(3):231-243.
• [17] Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313.
• [18] Role and development of GLP-1 receptor agonists in the management of diabetes. Diabetes Metab Syndr Obes. 2009; 2: 37-49.
• [19] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [20] LY3437943, a novel triple glucagon, GIP, and GLP-1 receptor agonist for glycemic control and weight loss: From discovery to clinical proof of concept. Cell Metab. 2022 Sep 6;34(9):1234-1247.e9.
• [21] GLP-1 Receptor Agonist NLY01 Reduces Retinal Inflammation and Neuron Death Secondary to Ocular Hypertension. Cell Rep. 2020 Nov 3;33(5):108271.
• [22] Clinical pipeline report, company report or official report of Novo Nordisk A/S.
• [23] Novel glucagon-like peptide-1 analog delivered orally reduces postprandial glucose excursions in porcine and canine models. J Diabetes Sci Technol. 2010 Nov 1;4(6):1516-23.
• [24] On-target Effects of GLP-1 Receptor Agonists on Thyroid C-cells in Rats and Mice. Toxicol Pathol February 2013 vol. 41 no. 2 303-309.
• [25] Differential GLP-1R Binding and Activation by Peptide and Non-peptide Agonists. Mol Cell. 2020 Nov 5;80(3):485-500.e7.
• [26] ClinicalTrials.gov (NCT05579977) A PHASE 2, RANDOMIZED, DOUBLE-BLIND, PLACEBO CONTROLLED, DOSE RANGING, DOSE FINDING, PARALLEL GROUP STUDY TO ASSESS EFFICACY AND SAFETY OF PF-07081532, AND OPEN LABEL ORAL SEMAGLUTIDE, IN ADULTS WITH TYPE 2 DIABETES MELLITUS (T2DM) INADEQUATELY CONTROLLED ON METFORMIN, AND SEPARATELY PF-07081532 COMPARED TO MATCHING PLACEBO IN ADULTS WITH OBESITY BUT WITHOUT T2DM. U.S.National Institutes of Health.
• [27] Clinical pipeline report, company report or official report of Regor Therapeutics
• [28] Antibody semorinemab reduces tau pathology in a transgenic mouse model and engages tau in patients with Alzheimer's disease. Sci Transl Med. 2021 May 12;13(593):eabb2639.
• [29] Relationship between systemic cytokines and complement factor H Y402H polymorphism in patients with dry age-related macular degeneration. Am J Ophthalmol. 2013 Dec;156(6):1176-83.
• [30] Small Molecule Drug Discovery at the Glucagon-Like Peptide-1 Receptor. Exp Diabetes Res. 2012; 2012: 709893.
• [31] Exenatide and liraglutide: different approaches to develop GLP-1 receptor agonists (incretin mimetics)--preclinical and clinical results. Best Pract Res Clin Endocrinol Metab. 2009 Aug;23(4):463-77.
• [32] Clinical pipeline report, company report or official report of AstraZeneca
• [33] GLP-1 receptor activation inhibits VLDL production and reverses hepatic steatosis by decreasing hepatic lipogenesis in high-fat-fed APOE*3-Leiden mice. PLoS One. 2012;7(11):e49152.
• [34] Clinical pipeline report, company report or official report of Carmot Therapeutics.
• [35] Chemically programmed antibodies. Trends Biotechnol. 2014 April; 32(4): 186-197.
• [36] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2023. Adis Insight
• [37] GZR18, a novel long-acting GLP-1 analog, demonstrated positive in vitro and in vivo pharmacokinetic and pharmacodynamic characteristics in animal models. Eur J Pharmacol. 2022 Aug 5;928:175107.
• [38] IBI362?(LY3305677), a weekly-dose GLP-1 and glucagon receptor dual agonist, in Chinese adults with overweight or obesity: A randomised, placebo-controlled, multiple ascending dose phase 1b study. EClinicalMedicine. 2021 Aug 13;39:101088.
• [39] Clinical pipeline report, company report or official report of Addex Pharmaceuticals.
• [40] Clinical pipeline report, company report or official report of Novo Nordisk A/S.
• [41] Effects of ALT-801, a GLP-1 and glucagon receptor dual agonist, in a translational mouse model of non-alcoholic steatohepatitis. Sci Rep. 2022 Apr 23;12(1):6666.
• [42] Company report (Sanofi) (drug: LIXisenatide)
• [43] Company report (Zealandpharma)
• [44] 2011 Pipeline of Zydus Cadila Group.
• [45] Pharmacokinetics and tolerability of a novel long-acting glucagon-like peptide-1 analog, CJC-1131, in healthy and diabetic subjects. Int J Clin Pharmacol Ther. 2008 Sep;46(9):443-52.
• [46] Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2003 Sep;25(7):565-97.
• [47] Company report (Roche pipeline: October 16, 2012)
• [48] Reversal of diabetes in rats using GLP-1-expressing adult pancreatic duct-like precursor cells transformed from acinar to ductal cells. Stem Cells Dev. 2009 Sep;18(7):991-1002.
• [49] Glucagon-like peptide-1 analogue LY315902: effect on intestinal motility and release of insulin and somatostatin. Regul Pept. 2002 Jun 15;106(1-3):89-95.
• [50] Clinical pipeline report, company report or official report of CinFina Pharma
• [51] US patent application no. 2011,0171,312, Modified therapeutic peptides, methods of their preparation and use.
• [52] 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
• [53] A potentiator of orthosteric ligand activity at GLP-1R acts via covalent modification. Nat Chem Biol. 2014 Aug;10(8):629-31.
• [54] Design and synthesis of conformationally constrained glucagon-like peptide-1 derivatives with increased plasma stability and prolonged in vivo acti... J Med Chem. 2008 May 8;51(9):2758-65.
• [55] Identification of CJC-1131-albumin bioconjugate as a stable and bioactive GLP-1(7-36) analog. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4395-8.
• [56] Search for alpha-helical propensity in the receptor-bound conformation of glucagon-like peptide-1. Bioorg Med Chem. 2008 Dec 1;16(23):10106-12.