Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T08391
|
||||
| Former ID |
TTDC00187
|
||||
| Target Name |
Tyrosine-protein kinase JAK2
|
||||
| Gene Name |
JAK2
|
||||
| Synonyms |
JAK-2; Janus kinase 2; JAK2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Anemia [ICD9: 280-285; ICD10: D50-D64] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Essential thrombocythemia [ICD9: 238.71, 289.9; ICD10: D47.3, D75.2, D75.8] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Malignancies [ICD9: 140-239; ICD10: C00-C96] | |||||
| Myeloproliferative neoplasm; Breast cancer [ICD9:205.1, 238.4, 289.89, 289.9, 174, 175; ICD10: D47.1, C50] | |||||
| Myelofibrosis [ICD9: 208.9, 289.83, 709.2; ICD10: C94.4, D47.4] | |||||
| Myelofibrosis; Essential thrombocythemia; Polycythemia vera [ICD9: 238.71, 289.0, 289.83, 289.9, 776.4; ICD10: C94.4, D47.1, D47.3, D75.1, D75.2, D75.8, P61.1] | |||||
| Myeloproliferative disorder [ICD10: C94.6] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Polycythemia vera [ICD9: 238.4; ICD10: D45] | |||||
| Renal transplantation; Multiple myeloma [ICD9:279.5, 203; ICD10: D89.8, C90] | |||||
| Rheumatold arthritis; Psoriasis; Diabetic nephropathy [ICD9: 250, 250.4, 580-599, 696, 710-719, 714; ICD10: E08-E13, E10.2, E11.2, E13.2, L40, M00-M25, M05-M06, N00-N29] | |||||
| Function |
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins. Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain. Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated,dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation. Plays a role in cell cycle by phosphorylating CDKN1B. Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In thenucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T08391
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.2
|
||||
| Sequence |
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Ruxolitinib | Drug Info | Phase 4 | Essential thrombocythemia | [523729], [541031] |
| Baricitinib | Drug Info | Phase 3 | Rheumatold arthritis; Psoriasis; Diabetic nephropathy | [524953], [542743] | |
| Momelotinib | Drug Info | Phase 3 | Myelofibrosis | [524489], [542742] | |
| Pacritinib | Drug Info | Phase 3 | Myelofibrosis | [524636], [542744], [550572] | |
| Ruxolitinib | Drug Info | Phase 3 | Pancreatic cancer | [524723], [541031] | |
| XL019 | Drug Info | Phase 3 | Cancer | [532295], [542887] | |
| AZD1480 | Drug Info | Phase 2 | Myeloproliferative disorder | [532522], [541219] | |
| BMS-911543 | Drug Info | Phase 2 | Myelofibrosis | [531666], [542870] | |
| INCB039110 | Drug Info | Phase 2 | Malignancies | [543090] | |
| ITF2357 | Drug Info | Phase 2 | Myelofibrosis; Essential thrombocythemia; Polycythemia vera | [537520], [542513] | |
| LY2784544 | Drug Info | Phase 2 | Myeloproliferative neoplasm; Breast cancer | [523899], [542831], [549758] | |
| Ruxolitinib | Drug Info | Approved | High-risk myelofibrosis | [524601], [533122], [541031], [556264] | |
| Cerdulatinib | Drug Info | Phase 1/2 | Non-hodgkin's lymphoma | [551978] | |
| NS-018 | Drug Info | Phase 1/2 | Myelofibrosis | [532622], [542781] | |
| TG101348 | Drug Info | Phase 1/2 | Myelofibrosis | [537520] | |
| AC430 | Drug Info | Phase 1 | Leukemia | [523342] | |
| Peginterferon beta | Drug Info | Phase 1 | Multiple scierosis | [549138] | |
| SB-1578 | Drug Info | Phase 1 | Cancer | [523243] | |
| XL019 | Drug Info | Phase 1 | Polycythemia vera | [537520], [542887] | |
| AG490 | Drug Info | Terminated | Renal transplantation; Multiple myeloma | [541206], [546151] | |
| Inhibitor | 5-phenyl-1H-indazol-3-amine | Drug Info | [551374] | ||
| AG490 | Drug Info | [535970] | |||
| AMG-JAK2-01 | Drug Info | [543545] | |||
| Atropisomer 1 | Drug Info | [530583] | |||
| AZ960 | Drug Info | [529674] | |||
| BVB-808 | Drug Info | [543545] | |||
| CMP-6 | Drug Info | [526307] | |||
| compound 19a | Drug Info | [532598] | |||
| compound 1d | Drug Info | [531435] | |||
| EPO program, Medexgen | Drug Info | [543545] | |||
| INCB039110 | Drug Info | [543545] | |||
| ITF2357 | Drug Info | [537114], [537520] | |||
| Jak2 inhibitors | Drug Info | [543545] | |||
| Jak2 tyrosine inhibitors | Drug Info | [543545] | |||
| K-454 | Drug Info | [543545] | |||
| NSC-1771 | Drug Info | [531262] | |||
| ON-044580 | Drug Info | [531107] | |||
| Peginterferon beta | Drug Info | [529516] | |||
| SB-1578 | Drug Info | [532038], [532777] | |||
| SGI-1252 | Drug Info | [543545] | |||
| TG101348 | Drug Info | [531331], [537520] | |||
| Tyrphostin AG490 | Drug Info | [535289] | |||
| WHI-P154 | Drug Info | [529228] | |||
| XL019 | Drug Info | [537520] | |||
| Modulator | AC430 | Drug Info | [532777] | ||
| AZD1480 | Drug Info | [530557] | |||
| Baricitinib | Drug Info | [532777] | |||
| BMS-911543 | Drug Info | [531666] | |||
| Cerdulatinib | Drug Info | ||||
| LY2784544 | Drug Info | [532307] | |||
| Momelotinib | Drug Info | ||||
| NS-018 | Drug Info | [532622] | |||
| Pacritinib | Drug Info | [550433] | |||
| Ruxolitinib | Drug Info | [531783] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | Chemokine signaling pathway | ||||
| PI3K-Akt signaling pathway | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Jak-STAT signaling pathway | |||||
| Cholinergic synapse | |||||
| Prolactin signaling pathway | |||||
| Adipocytokine signaling pathway | |||||
| Leishmaniasis | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Measles | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Interferon-gamma signaling pathway | |||||
| JAK/STAT signaling pathway | |||||
| PDGF signaling pathway | |||||
| PI3 kinase pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Endothelins | ||||
| ErbB4 signaling events | |||||
| GMCSF-mediated signaling events | |||||
| IL4-mediated signaling events | |||||
| IL27-mediated signaling events | |||||
| Signaling events mediated by PTP1B | |||||
| IL12-mediated signaling events | |||||
| S1P3 pathway | |||||
| SHP2 signaling | |||||
| CXCR4-mediated signaling events | |||||
| IL5-mediated signaling events | |||||
| IFN-gamma pathway | |||||
| ErbB2/ErbB3 signaling events | |||||
| IL3-mediated signaling events | |||||
| IL6-mediated signaling events | |||||
| PDGFR-beta signaling pathway | |||||
| IL23-mediated signaling events | |||||
| Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
| EPO signaling pathway | |||||
| Notch-mediated HES/HEY network | |||||
| Reactome | Interleukin-6 signaling | ||||
| MAPK3 (ERK1) activation | |||||
| MAPK1 (ERK2) activation | |||||
| GPVI-mediated activation cascade | |||||
| Prolactin receptor signaling | |||||
| RMTs methylate histone arginines | |||||
| gamma signalling through PI3Kgamma | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| RAF activation | |||||
| RAF/MAP kinase cascade | |||||
| Interferon gamma signaling | |||||
| Regulation of IFNG signaling | |||||
| Interleukin receptor SHC signaling | |||||
| Growth hormone receptor signaling | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| WikiPathways | Serotonin Receptor 2 and STAT3 Signaling | ||||
| Type II interferon signaling (IFNG) | |||||
| Notch Signaling Pathway | |||||
| EPO Receptor Signaling | |||||
| EGF/EGFR Signaling Pathway | |||||
| IL-4 Signaling Pathway | |||||
| IL-6 signaling pathway | |||||
| Kit receptor signaling pathway | |||||
| IL-3 Signaling Pathway | |||||
| Mesodermal Commitment Pathway | |||||
| Interleukin-2 signaling | |||||
| Signaling by SCF-KIT | |||||
| Prolactin receptor signaling | |||||
| Growth hormone receptor signaling | |||||
| JAK/STAT | |||||
| BDNF signaling pathway | |||||
| Oncostatin M Signaling Pathway | |||||
| Interleukin-11 Signaling Pathway | |||||
| AGE/RAGE pathway | |||||
| TSLP Signaling Pathway | |||||
| IL17 signaling pathway | |||||
| Leptin signaling pathway | |||||
| TSH signaling pathway | |||||
| Interleukin-3, 5 and GM-CSF signaling | |||||
| Interferon gamma signaling | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 523243 | ClinicalTrials.gov (NCT01235871) A Single and Multiple-Dose Study of SB1578. U.S. National Institutes of Health. | ||||
| Ref 523342 | ClinicalTrials.gov (NCT01287858) Study to Assess Safety, Tolerability, and Pharmacokinetics of Oral Doses for AC430 in Healthy Subjects. U.S. National Institutes of Health. | ||||
| Ref 523729 | ClinicalTrials.gov (NCT01493414) INC424 for Patients With Myelofibrosis, Post Polycythemia Myelofibrosis or Post-essential Thrombocythemia Myelofibrosis. U.S. National Institutes of Health. | ||||
| Ref 523899 | ClinicalTrials.gov (NCT01594723) A Study of LY2784544 in Participants With Myeloproliferative Neoplasms. U.S. National Institutes of Health. | ||||
| Ref 524489 | ClinicalTrials.gov (NCT01969838) Momelotinib Versus Ruxolitinib in Subjects With Myelofibrosis. U.S. National Institutes of Health. | ||||
| Ref 524601 | ClinicalTrials.gov (NCT02038036) Ruxolitinib Efficacy and Safety in Patients With HU Resistant or Intolerant Polycythemia Vera vs Best Available Therapy.. U.S. National Institutes of Health. | ||||
| Ref 524636 | ClinicalTrials.gov (NCT02055781) Oral Pacritinib Versus Best Available Therapy to Treat Myelofibrosis With Thrombocytopenia. U.S. National Institutes of Health. | ||||
| Ref 524723 | ClinicalTrials.gov (NCT02117479) Study of Ruxolitinib in Pancreatic Cancer Patients (Janus 1). U.S. National Institutes of Health. | ||||
| Ref 524953 | ClinicalTrials.gov (NCT02265705) A Study of Baricitinib (LY3009104) in Participants With Rheumatoid Arthritis (RA). U.S. National Institutes of Health. | ||||
| Ref 531666 | Characterization of BMS-911543, a functionally selective small-molecule inhibitor of JAK2. Leukemia. 2012 Feb;26(2):280-8. | ||||
| Ref 532295 | Update on JAK2 Inhibitors in Myeloproliferative Neoplasm. Ther Adv Hematol. 2011 Apr;2(2):61-71. | ||||
| Ref 532522 | The Janus kinases inhibitor AZD1480 attenuates growth of small cell lung cancers in vitro and in vivo. Clin Cancer Res. 2013 Dec 15;19(24):6777-86. | ||||
| Ref 532622 | Effect of NS-018, a selective JAK2V617F inhibitor, in a murine model of myelofibrosis. Blood Cancer J. 2014 Jan 10;4:e174. | ||||
| Ref 533122 | Ruxolitinib versus standard therapy for the treatment of polycythemia vera. N Engl J Med. 2015 Jan 29;372(5):426-35. | ||||
| Ref 537520 | Emerging drugs for the therapy of primary and post essential thrombocythemia, post polycythemia vera myelofibrosis. Expert Opin Emerg Drugs. 2009 Jun 24. | ||||
| Ref 541031 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5688). | ||||
| Ref 541206 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5916). | ||||
| Ref 541219 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5933). | ||||
| Ref 542513 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7490). | ||||
| Ref 542742 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7791). | ||||
| Ref 542743 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7792). | ||||
| Ref 542744 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7793). | ||||
| Ref 542781 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7839). | ||||
| Ref 542831 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7909). | ||||
| Ref 542870 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7954). | ||||
| Ref 542887 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7971). | ||||
| Ref 543090 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8364). | ||||
| Ref 546151 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006610) | ||||
| Ref 549138 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032732) | ||||
| Ref 526307 | Photochemical preparation of a pyridone containing tetracycle: a Jak protein kinase inhibitor. Bioorg Med Chem Lett. 2002 Apr 22;12(8):1219-23. | ||||
| Ref 529228 | The specificity of JAK3 kinase inhibitors. Blood. 2008 Feb 15;111(4):2155-7. Epub 2007 Dec 19. | ||||
| Ref 529516 | Comparison of mutated ABL1 and JAK2 as oncogenes and drug targets in myeloproliferative disorders. Leukemia. 2008 Jul;22(7):1320-34. | ||||
| Ref 529674 | Effects of the JAK2 inhibitor, AZ960, on Pim/BAD/BCL-xL survival signaling in the human JAK2 V617F cell line SET-2. J Biol Chem. 2008 Nov 21;283(47):32334-43. | ||||
| Ref 530557 | The JAK2 inhibitor AZD1480 potently blocks Stat3 signaling and oncogenesis in solid tumors. Cancer Cell. 2009 Dec 8;16(6):487-97. | ||||
| Ref 530583 | J Med Chem. 2009 Dec 24;52(24):7938-41.Janus kinase 2 inhibitors. Synthesis and characterization of a novel polycyclic azaindole. | ||||
| Ref 531107 | A Non-ATP-Competitive Dual Inhibitor of JAK2 and BCR-ABL Kinases: Elucidation of a Novel Therapeutic Spectrum Based on Substrate Competitive Inhibition. Genes Cancer. 2010 Apr;1(4):331-45. | ||||
| Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
| Ref 531331 | Safety and efficacy of TG101348, a selective JAK2 inhibitor, in myelofibrosis. J Clin Oncol. 2011 Mar 1;29(7):789-96. | ||||
| Ref 531435 | In vitro and in vivo evaluation of 6-aminopyrazolyl-pyridine-3-carbonitriles as JAK2 kinase inhibitors. Bioorg Med Chem Lett. 2011 May 15;21(10):2958-61. | ||||
| Ref 531666 | Characterization of BMS-911543, a functionally selective small-molecule inhibitor of JAK2. Leukemia. 2012 Feb;26(2):280-8. | ||||
| Ref 532038 | SB1578, a novel inhibitor of JAK2, FLT3, and c-Fms for the treatment of rheumatoid arthritis. J Immunol. 2012 Oct 15;189(8):4123-34. | ||||
| Ref 532307 | Discovery and characterization of LY2784544, a small-molecule tyrosine kinase inhibitor of JAK2V617F. Blood Cancer J. 2013 Apr 12;3:e109. | ||||
| Ref 532598 | Discovery of 1-methyl-1H-imidazole derivatives as potent Jak2 inhibitors. J Med Chem. 2014 Jan 9;57(1):144-58. | ||||
| Ref 532622 | Effect of NS-018, a selective JAK2V617F inhibitor, in a murine model of myelofibrosis. Blood Cancer J. 2014 Jan 10;4:e174. | ||||
| Ref 532777 | Selective JAK inhibitors in development for rheumatoid arthritis. Expert Opin Investig Drugs. 2014 Aug;23(8):1067-77. | ||||
| Ref 535289 | The JAK2 inhibitor AG490 predominantly abrogates the growth of human B-precursor leukemic cells with 11q23 translocation or Philadelphia chromosome. Leukemia. 2001 Nov;15(11):1758-68. | ||||
| Ref 535970 | Jak2 tyrosine kinase mediates oxidative stress-induced apoptosis in vascular smooth muscle cells. J Biol Chem. 2004 Aug 13;279(33):34547-52. Epub 2004 May 24. | ||||
| Ref 537520 | Emerging drugs for the therapy of primary and post essential thrombocythemia, post polycythemia vera myelofibrosis. Expert Opin Emerg Drugs. 2009 Jun 24. | ||||
