Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T83793
|
||||
| Former ID |
TTDR00778
|
||||
| Target Name |
Negative factor
|
||||
| Gene Name |
nef
|
||||
| Synonyms |
27 kDa protein; 3'ORF; F-protein; Nef protein; nef
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | ||||
| Function |
Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.
|
||||
| BioChemical Class |
Lentivirus primate group Nef
|
||||
| UniProt ID | |||||
| Sequence |
MGGKWSKRSMGGWSAIRERMRRAEPRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCA
WLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYH TQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDA EKEVLVWRFDSKLAFHHMARELHPEYYKDC |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | F4co vaccine | Drug Info | Phase 2 | Human immunodeficiency virus infection | [523204], [548656] |
| LIPO-5 | Drug Info | Phase 2 | Human immunodeficiency virus infection | [523727] | |
| Ad35-GRIN | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [524697] | |
| Ad35-GRIN/ENV | Drug Info | Phase 1 | Human immunodeficiency virus infection | [523741] | |
| GSK-732461 | Drug Info | Discontinued in Phase 2 | Human immunodeficiency virus infection | [548656] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| DRM | DRM Info | ||||
| References | |||||
| Ref 523204 | ClinicalTrials.gov (NCT01218113) Efficacy and Safety of GSK Biologicals HIV Vaccine in Antiretroviral Therapy (ART)-naive HIV-1 Infected Persons. U.S. National Institutes of Health. | ||||
| Ref 523727 | ClinicalTrials.gov (NCT01492985) Lipopeptide Immunisation With GTU-multiHIV Trial. U.S. National Institutes of Health. | ||||
| Ref 523741 | ClinicalTrials.gov (NCT01496989) Safety and Immunogenicity Study of HIV-MAG Vaccine +/- IL-12 and Ad35-GRIN/ENV in HIV-uninfected Volunteers. U.S. National Institutes of Health. | ||||
| Ref 531994 | A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936. | ||||
| Ref 533201 | HIV specific responses induced in nonhuman primates with ANRS HIV-Lipo-5 vaccine combined with rMVA-HIV prime or boost immunizations. Vaccine. 2015 May 11;33(20):2354-9. | ||||
