Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE0QLUZ)
DME Name | Oxygen-insensitive NADPH nitroreductase B (nfsB) | ||||
---|---|---|---|---|---|
Synonyms | Oxygen-insensitive NAD(P)H nitroreductase B; Dihydropteridine reductase; FMN-dependent nitroreductase; JW0567; b0578; ntr; pnrB | ||||
Gene Name | nfsB | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 1.5.1.34 | ||||
Lineage | Species: Escherichia coli | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV |
||||
Function |
This enzyme can reduce a variety of nitroaromatic compounds using NADH (and to lesser extent NADPH) as source of reducing equivalents; two electrons are transferred. And it can reduce nitrofurazone, quinones and the anti-tumor agent CB1954 (5-(aziridin-1-yl)-2,4-dinitrobenzamide).
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
4 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||||||||
1 Discontinued Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||||||||
2 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||||||||
References