Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3PZ0I)

DME Name Histamine N-methyltransferase (HNMT)
Synonyms Histamine 1-methyltransferase; Histamine-methylating enzyme; Imidazole methyltransferase; Imidazole N-methyltransferase; Imidazolemethyltransferase; HMT; HNMT
Gene Name HNMT
UniProt ID
HNMT_HUMAN
INTEDE ID
DME0143
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3176
EC Number EC: 2.1.1.8
Transferase
Methylase
Methyltransferase
EC: 2.1.1.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIG
GGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETS
SEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD
KLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLL
WDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Function This enzyme inactivates histamine by N-methylation and plays an important role in degrading histamine.
KEGG Pathway
Histidine metabolism (hsa00340 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Metabolism of ingested SeMet, Sec, MeSec into H2Se (R-HSA-2408508 )
Histidine catabolism (R-HSA-70921 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ergotidine DM78IME Osteoarthritis FA00-FA05 Approved [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.30E-01 -8.33E-02 -4.35E-01
Alopecia ED70 Skin from scalp 1.60E-07 4.12E-01 1.21E+00
Alzheimer's disease 8A20 Entorhinal cortex 9.15E-03 6.93E-02 3.56E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.92E-01 1.01E-01 2.51E-01
Aortic stenosis BB70 Calcified aortic valve 4.94E-01 5.78E-02 3.99E-01
Apnea 7A40 Hyperplastic tonsil 1.09E-01 1.33E-01 6.03E-01
Arthropathy FA00-FA5Z Peripheral blood 3.97E-01 1.50E-01 5.67E-01
Asthma CA23 Nasal and bronchial airway 1.46E-03 -2.77E-01 -3.05E-01
Atopic dermatitis EA80 Skin 8.15E-02 -1.12E-01 -5.47E-01
Autism 6A02 Whole blood 8.48E-01 -5.95E-02 -2.73E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.16E-01 -2.63E-01 -6.71E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.89E-04 -2.51E-01 -1.35E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.87E-01 4.64E-02 1.72E-01
Batten disease 5C56.1 Whole blood 4.69E-01 7.50E-02 2.14E-01
Behcet's disease 4A62 Peripheral blood 1.12E-01 1.92E-01 5.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.39E-01 -1.85E-02 -9.88E-02
Bladder cancer 2C94 Bladder tissue 1.53E-04 -9.39E-01 -2.79E+00
Breast cancer 2C60-2C6Z Breast tissue 5.38E-66 -4.62E-01 -1.37E+00
Cardioembolic stroke 8B11.20 Whole blood 4.08E-04 4.88E-01 1.18E+00
Cervical cancer 2C77 Cervical tissue 4.51E-01 -1.45E-01 -3.22E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.82E-01 -5.17E-02 -1.30E-01
Chronic hepatitis C 1E51.1 Whole blood 5.43E-01 -9.53E-02 -1.85E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.08E-01 -1.38E-03 -6.26E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.20E-04 -1.66E-01 -4.37E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.64E-01 -1.00E-01 -2.33E-01
Colon cancer 2B90 Colon tissue 2.48E-09 -1.74E-01 -5.05E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.21E-01 -1.84E-01 -8.08E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.11E-01 -1.78E-01 -1.11E+00
Endometriosis GA10 Endometrium tissue 5.11E-03 4.32E-01 1.42E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.28E-01 -1.72E-01 -7.70E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.48E-10 1.16E+00 2.06E+00
Gastric cancer 2B72 Gastric tissue 1.25E-01 4.02E-01 1.45E+00
Glioblastopma 2A00.00 Nervous tissue 5.18E-62 4.45E-01 2.04E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.68E-01 -1.86E-01 -5.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.69E-01 3.64E-01 3.67E-01
Head and neck cancer 2D42 Head and neck tissue 1.31E-13 -3.34E-01 -8.91E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.70E-02 2.79E-01 1.01E+00
Huntington's disease 8A01.10 Whole blood 6.72E-01 -4.03E-03 -2.17E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.90E-02 6.38E-01 1.24E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.15E-01 2.28E-02 2.31E-01
Influenza 1E30 Whole blood 2.68E-01 -1.27E+00 -1.29E+00
Interstitial cystitis GC00.3 Bladder tissue 9.82E-03 -6.54E-01 -3.58E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.82E-01 1.35E-01 6.64E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.14E-03 -1.65E-01 -5.46E-01
Ischemic stroke 8B11 Peripheral blood 1.27E-01 -5.68E-02 -1.34E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.54E-02 9.80E-03 1.22E-02
Lateral sclerosis 8B60.4 Skin 1.30E-01 2.34E-01 1.14E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.32E-03 1.43E-01 2.75E+00
Liver cancer 2C12.0 Liver tissue 2.26E-03 -5.27E-01 -7.73E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.46E-05 4.80E-01 2.62E+00
Lung cancer 2C25 Lung tissue 1.17E-47 -5.59E-01 -1.35E+00
Lupus erythematosus 4A40 Whole blood 2.42E-03 3.69E-01 3.20E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.96E-01 -3.52E-02 -2.03E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.23E-01 1.25E-01 3.37E-01
Melanoma 2C30 Skin 7.78E-01 -2.53E-02 -3.27E-02
Multiple myeloma 2A83.1 Peripheral blood 1.16E-01 2.22E-02 1.82E-01
Multiple myeloma 2A83.1 Bone marrow 1.55E-01 -2.28E-01 -4.83E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.83E-01 1.62E-02 7.03E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.09E-05 3.30E-01 1.11E+00
Myelofibrosis 2A20.2 Whole blood 4.79E-01 1.42E-01 7.73E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.59E-06 6.14E-01 9.11E-01
Myopathy 8C70.6 Muscle tissue 1.57E-06 5.24E-01 4.64E+00
Neonatal sepsis KA60 Whole blood 1.79E-12 2.37E-01 1.01E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.85E-06 -5.08E-01 -2.61E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.95E-01 -6.76E-03 -3.84E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.75E-01 -1.25E-01 -1.41E+00
Olive pollen allergy CA08.00 Peripheral blood 3.28E-01 -9.15E-02 -7.49E-01
Oral cancer 2B6E Oral tissue 4.01E-02 -1.45E-01 -3.95E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.47E-01 -4.99E-03 -1.76E-02
Osteoporosis FB83.1 Bone marrow 3.58E-01 -5.28E-01 -8.69E-01
Ovarian cancer 2C73 Ovarian tissue 7.74E-04 -8.60E-01 -1.86E+00
Pancreatic cancer 2C10 Pancreas 1.67E-02 2.89E-01 7.00E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.70E-01 1.08E-01 5.85E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.19E-03 4.03E-01 1.28E+00
Pituitary cancer 2D12 Pituitary tissue 9.24E-01 6.52E-02 2.22E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.79E-01 -8.42E-02 -4.51E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.97E-01 -3.46E-02 -4.09E-01
Polycythemia vera 2A20.4 Whole blood 9.86E-02 1.07E-01 6.25E-01
Pompe disease 5C51.3 Biceps muscle 1.26E-02 4.55E-01 9.90E-01
Preterm birth KA21.4Z Myometrium 9.50E-01 8.15E-02 4.35E-01
Prostate cancer 2C82 Prostate 1.00E-04 2.09E+00 1.88E+00
Psoriasis EA90 Skin 2.71E-01 3.57E-02 9.43E-02
Rectal cancer 2B92 Rectal colon tissue 3.18E-02 -4.19E-01 -1.43E+00
Renal cancer 2C90-2C91 Kidney 4.28E-03 4.33E-01 1.59E+00
Retinoblastoma 2D02.2 Uvea 1.92E-04 6.99E-01 5.82E+00
Rheumatoid arthritis FA20 Synovial tissue 1.14E-01 1.57E-01 2.78E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.97E-01 1.43E-02 8.11E-02
Schizophrenia 6A20 Prefrontal cortex 6.81E-02 5.72E-02 1.46E-01
Schizophrenia 6A20 Superior temporal cortex 9.33E-01 -1.67E-02 -9.76E-02
Scleroderma 4A42.Z Whole blood 2.65E-02 9.00E-02 4.47E-01
Seizure 8A60-8A6Z Whole blood 6.35E-01 -9.15E-02 -4.53E-01
Sensitive skin EK0Z Skin 3.54E-01 -1.87E-01 -1.49E+00
Sepsis with septic shock 1G41 Whole blood 2.36E-07 9.81E-02 4.14E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.58E-01 -1.57E-01 -5.44E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.05E-01 -1.19E-01 -1.02E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.28E-01 3.01E-02 5.42E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.25E-02 5.32E-01 3.71E+00
Skin cancer 2C30-2C3Z Skin 2.23E-01 7.77E-04 1.41E-03
Thrombocythemia 3B63 Whole blood 8.96E-01 3.64E-03 1.99E-02
Thrombocytopenia 3B64 Whole blood 2.57E-01 3.66E-01 9.69E-01
Thyroid cancer 2D10 Thyroid 1.98E-01 4.51E-02 1.51E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.12E-06 9.31E-01 2.39E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.49E-02 4.33E-01 1.03E+01
Type 2 diabetes 5A11 Liver tissue 6.33E-01 -1.71E-01 -3.37E-01
Ureter cancer 2C92 Urothelium 3.13E-01 -9.15E-02 -4.91E-01
Uterine cancer 2C78 Endometrium tissue 5.54E-20 -5.81E-01 -1.25E+00
Vitiligo ED63.0 Skin 9.07E-01 -1.04E-01 -3.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Histamine N-methyltransferase (HNMT) DTT Info
DME DTT Type Successful
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amodiaquine DME4RA8 Malaria 1F40-1F45 Approved [1]
Diphenhydramine DMKQTBA Hyperemesis gravidarum Approved [2]
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Metoprine DM5GQD7 Advanced cancer 2A00-2F9Z Phase 2 [2]
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(L-)-S-adenosyl-L-homocysteine DMDUN83 Discovery agent N.A. Investigative [3]
4-(DIMETHYLAMINO)BUTYL IMIDOTHIOCARBAMATE DM68S9F Discovery agent N.A. Investigative [2]

References

1 Effect of amodiaquine, a histamine N-methyltransferase inhibitor, on, Propionibacterium acnes and lipopolysaccharide-induced hepatitis in mice. Eur J Pharmacol. 2007 Mar 8;558(1-3):179-84.
2 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
3 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
4 Histamine pharmacogenomics. Pharmacogenomics. 2009 May;10(5):867-83.