Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAZDL8)

DME Name UDP-glucuronosyltransferase 2B17 (UGT2B17)
Synonyms UDP-glucuronosyltransferase family 2 member B17; C19-steroid-specific UDP-glucuronosyltransferase; C19-steroid-specific UDPGT; UDPGT 2B17; UGT2B17
Gene Name UGT2B17
UniProt ID
UDB17_HUMAN
INTEDE ID
DME0066
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7367
EC Number EC: 2.4.1.17
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSA
SILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEY
SDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYT
VEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Function This enzyme has a major substrates eugenol > 4-methylumbelliferone > dihydrotestosterone (DHT) > androstane-3-alpha,17-beta-diol (3-alpha-diol) > testosterone > androsterone (ADT).
KEGG Pathway
Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucuronidation (R-HSA-156588 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Darolutamide DMV7YFT Prostate cancer 2C82.0 Approved [1]
Denopamine DM8C3GN Cardiac disease BA00-BE2Z Approved [2]
Vorinostat DMWMPD4 Adult acute monocytic leukemia Approved [3]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
MK-7246 DMLQOF1 Respiratory disease CB40 Phase 1 [4]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRN-1980310 DMOTU4P N. A. N. A. Investigative [5]
Hydroxybenzo(a)pyrene DM9H5EN N. A. N. A. Investigative [5]
Hydroxybenzo[a]pyrene DMFSKYE N. A. N. A. Investigative [5]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Denopamine Cardiac disease [BA00-BE2Z] Approved Km = 1.48 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.57E-03 -8.31E-03 -1.93E-02
Alopecia ED70 Skin from scalp 5.67E-02 6.74E-02 3.68E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.78E-02 2.50E-02 1.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.94E-01 1.17E-03 9.12E-03
Aortic stenosis BB70 Calcified aortic valve 9.22E-01 -6.59E-02 -7.83E-02
Apnea 7A40 Hyperplastic tonsil 6.44E-01 1.52E-01 3.75E-01
Arthropathy FA00-FA5Z Peripheral blood 3.27E-01 -1.77E-01 -5.35E-01
Asthma CA23 Nasal and bronchial airway 8.55E-02 9.14E-02 1.92E-01
Atopic dermatitis EA80 Skin 6.91E-01 6.52E-02 5.48E-01
Autism 6A02 Whole blood 9.69E-01 -1.99E-02 -7.31E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.04E-02 3.70E-01 3.24E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.28E-01 -5.03E-02 -5.01E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.75E-12 7.07E-01 1.30E+00
Batten disease 5C56.1 Whole blood 7.96E-02 -1.11E+00 -1.03E+00
Behcet's disease 4A62 Peripheral blood 6.62E-01 4.77E-02 1.79E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.78E-02 -7.68E-02 -8.28E-01
Bladder cancer 2C94 Bladder tissue 9.72E-03 2.37E-01 7.85E-01
Breast cancer 2C60-2C6Z Breast tissue 6.03E-01 -1.26E-01 -2.16E-01
Cardioembolic stroke 8B11.20 Whole blood 7.41E-01 -7.71E-02 -8.54E-02
Cervical cancer 2C77 Cervical tissue 3.16E-02 -4.54E-01 -3.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.66E-02 8.71E-02 5.89E-01
Chronic hepatitis C 1E51.1 Whole blood 1.17E-01 -6.44E-02 -7.42E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.41E-01 2.23E-02 2.14E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.74E-01 -2.31E-02 -1.67E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.33E-02 1.44E-01 1.06E+00
Colon cancer 2B90 Colon tissue 7.50E-26 -7.40E+00 -1.89E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.67E-01 -7.79E-02 -3.59E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.42E-01 -3.24E-02 -8.63E-02
Endometriosis GA10 Endometrium tissue 3.60E-01 -1.39E-02 -1.95E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.01E-01 -3.33E-02 -4.09E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.66E-03 -2.11E-01 -8.56E-01
Gastric cancer 2B72 Gastric tissue 5.36E-03 1.00E-01 7.34E-01
Glioblastopma 2A00.00 Nervous tissue 1.33E-02 9.46E-03 4.73E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.92E-03 1.33E-01 4.19E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.33E-01 -5.48E-02 -3.55E-01
Head and neck cancer 2D42 Head and neck tissue 4.86E-05 6.08E-02 2.79E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.71E-01 9.67E-02 1.78E-01
Huntington's disease 8A01.10 Whole blood 6.42E-01 4.84E-03 3.37E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.25E-01 -1.58E-02 -7.75E-02
Immunodeficiency 4A00-4A20 Peripheral blood 1.92E-01 3.87E-02 4.62E-01
Influenza 1E30 Whole blood 2.79E-02 1.80E-01 1.75E+00
Interstitial cystitis GC00.3 Bladder tissue 5.06E-02 2.54E-01 2.71E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.00E-01 -8.01E-02 -7.20E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.92E-01 -1.10E-01 -4.72E-02
Ischemic stroke 8B11 Peripheral blood 5.15E-01 6.29E-02 2.13E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.36E-02 -1.16E-01 -2.85E-01
Lateral sclerosis 8B60.4 Skin 8.27E-01 -1.79E-02 -7.03E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.83E-03 1.95E-01 1.50E+00
Liver cancer 2C12.0 Liver tissue 6.75E-04 -2.39E+00 -7.87E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.98E-02 -1.88E+00 -7.88E-01
Lung cancer 2C25 Lung tissue 2.95E-10 5.44E-02 2.04E-01
Lupus erythematosus 4A40 Whole blood 6.99E-01 -7.41E-02 -1.03E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.81E-02 -2.95E-02 -3.17E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.20E-01 -8.78E-03 -2.07E-02
Melanoma 2C30 Skin 7.75E-01 -2.95E-02 -1.24E-01
Multiple myeloma 2A83.1 Peripheral blood 2.27E-01 1.02E-01 5.57E-01
Multiple myeloma 2A83.1 Bone marrow 4.11E-03 1.46E+00 1.84E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.98E-01 -4.52E-03 -2.33E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.41E-01 -8.00E-02 -6.38E-01
Myelofibrosis 2A20.2 Whole blood 5.26E-01 1.79E-01 7.19E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.73E-01 -2.56E-02 -2.65E-02
Myopathy 8C70.6 Muscle tissue 7.34E-01 -6.20E-02 -1.46E+00
Neonatal sepsis KA60 Whole blood 2.35E-01 -6.39E-02 -2.88E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.93E-02 -1.38E-01 -7.21E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.97E-01 -2.99E+00 -1.07E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.93E-03 1.63E-01 2.26E+00
Olive pollen allergy CA08.00 Peripheral blood 1.16E-03 1.25E-01 3.53E+00
Oral cancer 2B6E Oral tissue 6.02E-02 1.06E-01 2.70E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.84E-01 5.75E-02 2.28E-01
Osteoporosis FB83.1 Bone marrow 7.75E-01 -6.76E-03 -4.56E-02
Ovarian cancer 2C73 Ovarian tissue 1.88E-04 5.05E-02 2.28E-01
Pancreatic cancer 2C10 Pancreas 5.09E-01 -4.31E-01 -2.99E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.93E-01 3.92E-02 5.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.05E-01 -5.04E-02 -3.31E-01
Pituitary cancer 2D12 Pituitary tissue 9.44E-01 -3.14E-02 -1.71E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.51E-01 -2.05E-02 -1.35E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.84E-01 -1.58E-02 -5.41E-02
Polycythemia vera 2A20.4 Whole blood 9.95E-07 2.12E-01 9.57E-01
Pompe disease 5C51.3 Biceps muscle 7.82E-01 7.54E-02 3.67E-01
Preterm birth KA21.4Z Myometrium 6.13E-01 -3.62E-02 -4.31E-01
Prostate cancer 2C82 Prostate 1.64E-01 -4.66E-03 -2.63E-02
Psoriasis EA90 Skin 2.69E-01 -9.94E-03 -5.91E-02
Rectal cancer 2B92 Rectal colon tissue 1.35E-02 -8.68E+00 -2.34E+00
Renal cancer 2C90-2C91 Kidney 2.78E-01 6.06E-02 2.15E-01
Retinoblastoma 2D02.2 Uvea 7.09E-01 -1.02E-01 -9.37E-01
Rheumatoid arthritis FA20 Synovial tissue 1.34E-01 1.38E-01 4.71E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.21E-01 3.35E-02 2.38E-01
Schizophrenia 6A20 Prefrontal cortex 9.36E-02 2.83E-02 9.35E-02
Schizophrenia 6A20 Superior temporal cortex 9.87E-01 -8.53E-03 -6.55E-02
Scleroderma 4A42.Z Whole blood 8.85E-01 9.52E-03 7.29E-02
Seizure 8A60-8A6Z Whole blood 6.21E-01 -5.28E-02 -2.60E-01
Sensitive skin EK0Z Skin 9.04E-01 0.00E+00 0.00E+00
Sepsis with septic shock 1G41 Whole blood 1.04E-02 -1.22E-02 -4.53E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.65E-02 2.42E-01 1.12E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.15E-01 -1.27E-01 -9.71E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.43E-01 -6.95E-02 -4.53E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.39E-01 3.48E-01 1.10E+00
Skin cancer 2C30-2C3Z Skin 4.64E-20 1.79E-01 9.73E-01
Thrombocythemia 3B63 Whole blood 5.21E-03 1.86E-01 7.67E-01
Thrombocytopenia 3B64 Whole blood 9.43E-01 0.00E+00 0.00E+00
Thyroid cancer 2D10 Thyroid 2.01E-01 -7.54E-03 -1.59E-02
Tibial muscular dystrophy 8C75 Muscle tissue 7.62E-01 1.33E-02 9.61E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.77E-01 3.53E-02 6.64E-01
Type 2 diabetes 5A11 Liver tissue 6.02E-01 -1.60E+00 -4.84E-01
Ureter cancer 2C92 Urothelium 4.78E-01 -1.13E-02 -7.81E-02
Uterine cancer 2C78 Endometrium tissue 4.80E-01 -6.06E-02 -4.43E-02
Vitiligo ED63.0 Skin 7.07E-01 1.47E-02 1.31E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
2 Regioselective glucuronidation of denopamine: marked species differences and identification of human udp-glucuronosyltransferase isoform. Drug Metab Dispos. 2005 Mar;33(3):403-12.
3 Age-dependent hepatic UDP-glucuronosyltransferase gene expression and activity in children. Front Pharmacol. 2016 Nov 16;7:437.
4 UGT2B17 genetic polymorphisms dramatically affect the pharmacokinetics of MK-7246 in healthy subjects in a first-in-human study. Clin Pharmacol Ther. 2012 Jul;92(1):96-102.
5 Importance of UDP-glucuronosyltransferase 1A10 (UGT1A10) in the detoxification of polycyclic aromatic hydrocarbons: decreased glucuronidative activity of the UGT1A10139Lys isoform. Drug Metab Dispos. 2006 Jun;34(6):943-9.