Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGPI81)

DME Name Angiotensin-converting enzyme 2 (ACE2)
Synonyms ACE-related carboxypeptidase; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2; ACE2; ACEH; Angiotensin-converting enzyme homolog; UNQ868/PRO1885
Gene Name ACE2
UniProt ID
ACE2_HUMAN
INTEDE ID
DME0446
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
59272
EC Number EC: 3.4.17.23
Hydrolases
Peptidase
Metallocarboxypeptidase
EC: 3.4.17.23
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
Function This enzyme converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7. It can also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency.
KEGG Pathway
Protein digestion and absorption (hsa04974 )
Renin-angiotensin system (hsa04614 )
Reactome Pathway
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Angiotensin-(1-7) DM76GZ0 Sarcoma 2A60-2C35 Phase 3 [5]
BRADYKININ DM4R6UV N. A. N. A. Phase 1 [6]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.38E-01 1.50E-04 1.38E-03
Alopecia ED70 Skin from scalp 4.89E-04 3.36E-01 7.40E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.62E-01 -1.43E-02 -1.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.66E-01 -6.28E-02 -7.23E-01
Aortic stenosis BB70 Calcified aortic valve 9.45E-01 7.82E-02 1.80E-01
Apnea 7A40 Hyperplastic tonsil 1.92E-01 -2.01E-01 -8.30E-01
Arthropathy FA00-FA5Z Peripheral blood 8.03E-02 6.99E-02 7.62E-01
Asthma CA23 Nasal and bronchial airway 8.78E-05 6.89E-01 7.04E-01
Atopic dermatitis EA80 Skin 3.23E-01 6.66E-02 3.78E-01
Autism 6A02 Whole blood 2.85E-01 -5.04E-02 -3.78E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.88E-01 -7.07E-02 -1.16E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.02E-01 2.26E-02 1.94E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.12E-06 -1.86E-01 -4.84E-01
Batten disease 5C56.1 Whole blood 9.78E-01 1.23E-02 9.66E-02
Behcet's disease 4A62 Peripheral blood 8.49E-01 3.64E-03 2.24E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.21E-01 3.43E-03 3.21E-02
Bladder cancer 2C94 Bladder tissue 3.79E-01 2.19E-02 6.90E-02
Breast cancer 2C60-2C6Z Breast tissue 2.08E-01 -3.20E-01 -7.31E-01
Cardioembolic stroke 8B11.20 Whole blood 5.71E-04 1.33E-01 1.05E+00
Cervical cancer 2C77 Cervical tissue 5.15E-02 -2.96E-01 -4.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.40E-02 4.03E-02 3.56E-01
Chronic hepatitis C 1E51.1 Whole blood 2.97E-01 4.77E-02 6.60E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.08E-02 6.45E-02 4.70E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.28E-02 -7.40E-02 -1.22E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.98E-01 8.30E-02 3.59E-01
Colon cancer 2B90 Colon tissue 5.11E-02 -1.12E-01 -1.16E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.70E-01 -4.35E-02 -2.83E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.86E-01 -2.17E-01 -1.20E+00
Endometriosis GA10 Endometrium tissue 5.69E-03 2.58E-01 1.02E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.11E-01 4.39E-02 4.10E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.90E-03 -9.59E-02 -6.96E-01
Gastric cancer 2B72 Gastric tissue 3.05E-01 1.27E+00 8.99E-01
Glioblastopma 2A00.00 Nervous tissue 6.32E-01 6.30E-03 2.97E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.61E-01 -3.93E-02 -9.54E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.71E-03 -3.44E-01 -1.57E+00
Head and neck cancer 2D42 Head and neck tissue 3.35E-04 -3.59E-01 -4.62E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.80E-01 -3.74E-02 -2.17E-01
Huntington's disease 8A01.10 Whole blood 5.43E-01 -2.34E-02 -1.69E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.46E-01 -1.94E-01 -6.97E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.03E-01 9.65E-02 9.66E-01
Influenza 1E30 Whole blood 4.94E-02 1.06E-01 1.75E+00
Interstitial cystitis GC00.3 Bladder tissue 7.51E-01 -1.32E-01 -4.05E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.94E-01 -5.59E-02 -5.47E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.58E-01 1.48E-02 2.15E-02
Ischemic stroke 8B11 Peripheral blood 6.43E-01 2.73E-02 3.09E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.32E-02 4.65E-02 2.20E-01
Lateral sclerosis 8B60.4 Skin 8.35E-01 -2.77E-02 -3.18E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.42E-04 1.80E-01 1.87E+00
Liver cancer 2C12.0 Liver tissue 1.22E-02 -5.94E-01 -1.01E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.08E-02 6.75E-01 2.91E+00
Lung cancer 2C25 Lung tissue 8.57E-41 3.20E-01 1.01E+00
Lupus erythematosus 4A40 Whole blood 9.56E-02 -5.10E-02 -2.04E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.98E-01 3.81E-02 3.52E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.06E-02 6.89E-02 3.08E-01
Melanoma 2C30 Skin 2.17E-02 -3.28E-01 -3.52E-01
Multiple myeloma 2A83.1 Peripheral blood 4.69E-01 -3.17E-02 -3.13E-01
Multiple myeloma 2A83.1 Bone marrow 2.65E-05 -3.71E-01 -3.48E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.53E-01 -1.55E-01 -9.07E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.51E-01 -1.65E-02 -1.69E-01
Myelofibrosis 2A20.2 Whole blood 1.61E-01 -1.63E-04 -1.75E-03
Myocardial infarction BA41-BA50 Peripheral blood 8.89E-02 5.22E-02 1.96E-01
Myopathy 8C70.6 Muscle tissue 7.25E-01 -2.82E-02 -1.91E-01
Neonatal sepsis KA60 Whole blood 2.01E-01 -4.13E-02 -2.69E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.40E-03 -3.65E-01 -1.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.37E-01 1.34E-01 1.49E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.07E-01 -1.47E-03 -9.47E-03
Olive pollen allergy CA08.00 Peripheral blood 4.68E-01 -1.23E-02 -6.24E-02
Oral cancer 2B6E Oral tissue 1.03E-04 3.52E-01 7.96E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.67E-02 -1.67E-01 -1.05E+00
Osteoporosis FB83.1 Bone marrow 5.23E-01 -1.99E-02 -7.88E-01
Ovarian cancer 2C73 Ovarian tissue 7.86E-01 4.38E-02 5.50E-02
Pancreatic cancer 2C10 Pancreas 3.19E-01 -6.96E-01 -3.99E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.61E-01 5.99E-04 1.36E-03
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.56E-01 -3.74E-03 -3.84E-02
Pituitary cancer 2D12 Pituitary tissue 2.26E-02 7.56E-02 7.03E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.45E-01 6.81E-02 6.00E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.07E-01 1.71E-02 1.27E-01
Polycythemia vera 2A20.4 Whole blood 2.47E-06 7.12E-02 6.93E-01
Pompe disease 5C51.3 Biceps muscle 8.90E-01 1.69E-02 1.72E-01
Preterm birth KA21.4Z Myometrium 5.29E-01 5.41E-01 1.26E+00
Prostate cancer 2C82 Prostate 3.24E-02 -2.25E-01 -2.73E-01
Psoriasis EA90 Skin 1.32E-39 7.65E-01 3.51E+00
Rectal cancer 2B92 Rectal colon tissue 5.76E-02 1.03E+00 1.13E+00
Renal cancer 2C90-2C91 Kidney 2.20E-01 -4.92E-01 -3.16E-01
Retinoblastoma 2D02.2 Uvea 5.21E-01 1.21E-02 1.41E-01
Rheumatoid arthritis FA20 Synovial tissue 4.52E-02 -2.94E-01 -1.33E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.18E-01 -3.33E-02 -1.35E-01
Schizophrenia 6A20 Prefrontal cortex 5.53E-01 3.15E-02 1.73E-01
Schizophrenia 6A20 Superior temporal cortex 1.02E-01 -2.20E-02 -2.84E-01
Scleroderma 4A42.Z Whole blood 1.77E-02 1.21E-01 1.15E+00
Seizure 8A60-8A6Z Whole blood 2.40E-01 6.91E-02 5.26E-01
Sensitive skin EK0Z Skin 3.72E-01 -1.31E-01 -3.56E-01
Sepsis with septic shock 1G41 Whole blood 6.34E-02 -2.91E-02 -1.83E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.18E-02 2.27E-01 1.20E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.62E-01 2.89E-02 1.62E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.75E-01 3.34E-02 6.95E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.81E-01 2.27E-01 5.65E-01
Skin cancer 2C30-2C3Z Skin 2.55E-01 -1.01E-01 -2.44E-01
Thrombocythemia 3B63 Whole blood 4.64E-02 8.84E-02 8.56E-01
Thrombocytopenia 3B64 Whole blood 6.04E-01 5.11E-02 6.20E-01
Thyroid cancer 2D10 Thyroid 4.42E-04 -1.90E-01 -4.71E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.73E-04 -1.48E-01 -1.24E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.64E-02 5.90E-02 1.63E+00
Type 2 diabetes 5A11 Liver tissue 3.93E-02 3.99E-01 1.10E+00
Ureter cancer 2C92 Urothelium 5.06E-01 -8.65E-03 -6.15E-02
Uterine cancer 2C78 Endometrium tissue 4.09E-04 3.54E-01 3.87E-01
Vitiligo ED63.0 Skin 8.93E-02 7.12E-01 1.46E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Angiotensin-converting enzyme 2 (ACE2) DTT Info
DME DTT Type Clinical trial
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
GSK2586881 DMU5EVR Acute lung injury NB32.3 Phase 2 [1]
ORE-1001 DM471ZH Diabetic complication 5A2Y Phase 1/2 [2]
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PMID18324760C28 DMCTFWE Discovery agent N.A. Investigative [3]
XNT DMPOGXU Discovery agent N.A. Investigative [4]

References

1 New Developments in the Pharmacological Treatment of Hypertension: Dead-End or a Glimmer at the Horizon . Curr Hypertens Rep. 2015; 17(6): 42.
2 Effects of the ACE2 inhibitor GL1001 on acute dextran sodium sulfate-induced colitis in mice. Inflamm Res. 2009 Nov;58(11):819-27.
3 Development of potent and selective phosphinic peptide inhibitors of angiotensin-converting enzyme 2. J Med Chem. 2008 Apr 10;51(7):2216-26.
4 Structure-based identification of small-molecule angiotensin-converting enzyme 2 activators as novel antihypertensive agents. Hypertension. 2008 May;51(5):1312-7.
5 Metabolism of angiotensin-(1-7) by angiotensin-converting enzyme. Hypertension. 1998 Jan;31(1 Pt 2):362-7.
6 Nunn's Applied Respiratory Physiology (Eighth Edition). Chapter 11 - Nonrespiratory Functions of the Lung.2017, Pages 203-214.e2