Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIVKZ8)

DME Name NADPH-dependent carbonyl reductase 3 (CBR3)
Synonyms Carbonyl reductase [NADPH] 3; Short chain dehydrogenase/reductase family 21C member 2; CBR3
Gene Name CBR3
UniProt ID
CBR3_HUMAN
INTEDE ID
DME0068
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
874
EC Number EC: 1.1.1.184
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.184
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRN
MCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTK
NEVHEREGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDS
IRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
Function This enzyme has low NADPH-dependent oxidoreductase activity towards 4- benzoylpyridine and menadione (in vitro).
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Daunorubicin DMQUSBT Acute monocytic leukemia Approved [1]
Menadione DMSJDTY Vitamin K deficiency 5B59 Approved [2]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Trastuzumab emtansine DMU1LXS HER2-positive breast cancer 2C60-2C65 Phase 2 [3]
4 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
1H-Indole-2,3-dione DMOZ91H Discovery agent N.A. Investigative [4]
ACMC-209cv7 DMQCSFB N. A. N. A. Investigative [2]
Nitrobenzaldehyde DM4UHB5 N. A. N. A. Investigative [2]
Phenanthrene-9,10-dione DMG8KS9 Discovery agent N.A. Investigative [5]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
1H-Indole-2,3-dione Discovery agent [N.A.] Investigative Km = 0.0078 microM [4]
Phenanthrene-9,10-dione Discovery agent [N.A.] Investigative Km = 0.0043 microM [4]
Menadione Vitamin K deficiency [5B59] Approved Km = 0.043 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.54E-07 1.99E-01 5.90E-01
Alopecia ED70 Skin from scalp 2.49E-02 -1.26E-01 -2.50E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.64E-02 1.12E-01 3.52E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.94E-01 2.39E-01 9.70E-01
Aortic stenosis BB70 Calcified aortic valve 7.35E-01 -3.22E-01 -2.77E-01
Apnea 7A40 Hyperplastic tonsil 2.37E-01 -1.38E+00 -1.26E+00
Arthropathy FA00-FA5Z Peripheral blood 8.85E-01 -1.13E-01 -2.45E-01
Asthma CA23 Nasal and bronchial airway 2.62E-05 9.83E-01 8.35E-01
Atopic dermatitis EA80 Skin 1.17E-06 5.06E-01 1.86E+00
Autism 6A02 Whole blood 2.66E-01 4.81E-03 1.06E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.35E-02 -2.45E-01 -1.97E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.04E-01 1.49E-02 7.24E-02
Bacterial infection of gingival 1C1H Gingival tissue 5.98E-21 -9.85E-01 -2.01E+00
Batten disease 5C56.1 Whole blood 4.96E-02 -3.24E-01 -8.70E-01
Behcet's disease 4A62 Peripheral blood 9.22E-01 -5.81E-02 -1.88E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.89E-01 -1.30E-02 -4.30E-02
Bladder cancer 2C94 Bladder tissue 6.30E-03 -4.44E-01 -1.53E+00
Breast cancer 2C60-2C6Z Breast tissue 4.00E-09 -3.43E-01 -6.73E-01
Cardioembolic stroke 8B11.20 Whole blood 2.19E-05 -9.90E-01 -1.40E+00
Cervical cancer 2C77 Cervical tissue 1.94E-03 -2.97E-01 -7.50E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.83E-01 -1.52E-01 -2.89E-01
Chronic hepatitis C 1E51.1 Whole blood 6.04E-01 -5.34E-03 -2.52E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.83E-01 -2.15E-02 -5.00E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.64E-06 8.02E-01 1.05E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.95E-02 5.30E-01 7.67E-01
Colon cancer 2B90 Colon tissue 3.20E-58 6.57E-01 1.67E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.94E-01 -1.66E-01 -4.35E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.63E-01 -1.89E-01 -2.87E-01
Endometriosis GA10 Endometrium tissue 1.94E-02 -4.53E-01 -4.72E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.49E-01 2.04E-01 3.96E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.30E-04 -5.58E-01 -1.63E+00
Gastric cancer 2B72 Gastric tissue 3.11E-01 6.15E-01 6.52E-01
Glioblastopma 2A00.00 Nervous tissue 1.96E-24 4.07E-01 7.62E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.21E-01 -2.06E-01 -3.61E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.28E-01 4.06E-01 4.50E-01
Head and neck cancer 2D42 Head and neck tissue 4.41E-01 -1.65E-01 -1.41E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.62E-01 -1.14E-02 -2.33E-02
Huntington's disease 8A01.10 Whole blood 3.70E-01 -1.94E-01 -2.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.17E-02 5.19E-01 1.75E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.09E-02 -5.11E-01 -2.03E+00
Influenza 1E30 Whole blood 1.85E-01 -3.12E-01 -1.34E+00
Interstitial cystitis GC00.3 Bladder tissue 9.44E-02 -2.05E-01 -7.22E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.22E-04 -8.22E-01 -3.26E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.46E-01 1.19E-02 3.25E-02
Ischemic stroke 8B11 Peripheral blood 7.71E-01 -5.05E-02 -9.43E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.09E-01 -1.12E-01 -1.63E-01
Lateral sclerosis 8B60.4 Skin 1.15E-01 1.80E-01 3.26E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.59E-02 3.84E-01 1.07E+00
Liver cancer 2C12.0 Liver tissue 1.36E-06 2.25E-01 6.28E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.00E-05 1.32E+00 6.49E+00
Lung cancer 2C25 Lung tissue 5.74E-32 3.47E-01 9.20E-01
Lupus erythematosus 4A40 Whole blood 8.76E-03 1.08E-02 1.59E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.25E-01 -1.72E-01 -5.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.99E-01 1.47E-01 2.55E-01
Melanoma 2C30 Skin 2.34E-01 -1.59E-01 -2.17E-01
Multiple myeloma 2A83.1 Peripheral blood 8.04E-01 6.23E-02 5.26E-02
Multiple myeloma 2A83.1 Bone marrow 5.73E-03 7.89E-02 6.61E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.51E-02 -3.05E-01 -1.06E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.12E-12 -4.44E-01 -1.89E+00
Myelofibrosis 2A20.2 Whole blood 8.66E-01 1.96E-02 9.11E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.69E-02 -3.81E-01 -4.36E-01
Myopathy 8C70.6 Muscle tissue 7.42E-02 1.73E-01 3.76E-01
Neonatal sepsis KA60 Whole blood 1.89E-21 -5.25E-01 -1.66E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.72E-05 5.53E-01 1.49E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.36E-02 -1.89E-01 -1.65E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.88E-01 -2.21E-01 -1.46E+00
Olive pollen allergy CA08.00 Peripheral blood 1.23E-01 -8.71E-01 -1.47E+00
Oral cancer 2B6E Oral tissue 1.80E-05 -1.26E+00 -1.14E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.37E-01 2.07E-01 2.96E-01
Osteoporosis FB83.1 Bone marrow 1.10E-03 -9.24E-01 -3.15E+00
Ovarian cancer 2C73 Ovarian tissue 3.34E-03 -8.04E-01 -1.50E+00
Pancreatic cancer 2C10 Pancreas 2.11E-05 4.14E-01 1.33E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.21E-01 -2.08E-01 -5.75E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.84E-02 -2.68E-01 -7.80E-01
Pituitary cancer 2D12 Pituitary tissue 3.41E-01 8.39E-02 2.33E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.31E-01 8.33E-02 2.40E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.67E-01 -3.90E-02 -1.83E-01
Polycythemia vera 2A20.4 Whole blood 1.66E-01 1.68E-02 7.83E-02
Pompe disease 5C51.3 Biceps muscle 7.59E-01 -1.53E-02 -3.93E-02
Preterm birth KA21.4Z Myometrium 1.84E-01 -4.28E-01 -1.30E+00
Prostate cancer 2C82 Prostate 7.27E-04 1.01E+00 9.72E-01
Psoriasis EA90 Skin 1.94E-21 4.76E-01 1.28E+00
Rectal cancer 2B92 Rectal colon tissue 8.56E-04 3.12E-01 1.86E+00
Renal cancer 2C90-2C91 Kidney 1.45E-05 7.15E-01 1.77E+00
Retinoblastoma 2D02.2 Uvea 5.51E-10 3.05E+00 1.01E+01
Rheumatoid arthritis FA20 Synovial tissue 2.24E-02 5.57E-01 8.17E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.86E-01 -8.84E-02 -1.71E-01
Schizophrenia 6A20 Prefrontal cortex 9.12E-01 3.16E-02 1.03E-01
Schizophrenia 6A20 Superior temporal cortex 6.65E-01 1.37E-01 5.05E-01
Scleroderma 4A42.Z Whole blood 5.75E-02 4.07E-01 8.63E-01
Seizure 8A60-8A6Z Whole blood 6.84E-03 4.96E-01 1.36E+00
Sensitive skin EK0Z Skin 9.42E-01 5.02E-02 2.64E-01
Sepsis with septic shock 1G41 Whole blood 4.31E-31 -4.70E-01 -1.36E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.97E-01 -1.70E-01 -4.49E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.11E-01 -6.05E-03 -3.26E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.47E-01 -8.11E-01 -5.83E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.91E-01 1.18E-01 3.68E-01
Skin cancer 2C30-2C3Z Skin 1.55E-01 -2.61E-02 -6.13E-02
Thrombocythemia 3B63 Whole blood 2.93E-01 7.47E-02 3.47E-01
Thrombocytopenia 3B64 Whole blood 4.65E-01 6.54E-01 8.94E-01
Thyroid cancer 2D10 Thyroid 1.23E-19 5.58E-01 1.70E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.20E-05 6.97E-01 2.22E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.76E-01 2.53E-01 7.91E-01
Type 2 diabetes 5A11 Liver tissue 2.03E-01 -7.34E-02 -3.03E-01
Ureter cancer 2C92 Urothelium 7.57E-01 -5.93E-03 -3.46E-02
Uterine cancer 2C78 Endometrium tissue 1.14E-02 -2.70E-01 -2.42E-01
Vitiligo ED63.0 Skin 7.17E-01 -3.91E-02 -1.60E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Naturally occurring variants of human CBR3 alter anthracycline in vitro metabolism. J Pharmacol Exp Ther. 2010 Mar;332(3):755-63.
2 Different functions between human monomeric carbonyl reductase 3 and carbonyl reductase 1. Mol Cell Biochem. 2008 Aug;315(1-2):113-21.
3 The role of carbonyl reducing enzymes in oxcarbazepine in vitro metabolism in man. Chem Biol Interact. 2014 Sep 5;220:241-7.
4 Analysis of the substrate-binding site of human carbonyl reductases CBR1 and CBR3 by site-directed mutagenesis. Chem Biol Interact. 2009 Mar 16;178(1-3):234-41.
5 Studies on reduction of S-nitrosoglutathione by human carbonyl reductases 1 and 3. Chem Biol Interact. 2011 May 30;191(1-3):95-103.