Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEP54UE)

DME Name Beta-glucuronidase (GUSB)
Synonyms Glucuronidase beta; Complex carbohydrate glycosidase; Beta-G1; GUSB
Gene Name GUSB
UniProt ID
BGLR_HUMAN
INTEDE ID
DME0106
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2990
EC Number EC: 3.2.1.31
Hydrolases
Glycosylase
O/S-glycosyl compound glycosidase
EC: 3.2.1.31
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
Function This enzyme Plays an important role in the degradation of dermatan and keratan sulfates.
KEGG Pathway
Drug metabolism - other enzymes (hsa00983 )
Glycosaminoglycan degradation (hsa00531 )
Lysosome (hsa04142 )
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Reactome Pathway
Hyaluronan uptake and degradation (R-HSA-2160916 )
MPS VII - Sly syndrome (R-HSA-2206292 )
Neutrophil degranulation (R-HSA-6798695 )
HS-GAG degradation (R-HSA-2024096 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chondroitin sulfate DM0N19Y N. A. N. A. Phase 4 [3]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
MK-4827 DMLYGH4 Ovarian cancer 2C73 Phase 3 [4]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tyropanoic acid DM91UKB N. A. N. A. Investigative [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.45E-03 4.22E-02 2.25E-01
Alopecia ED70 Skin from scalp 1.70E-01 7.38E-02 2.53E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.73E-06 1.32E-01 6.22E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.63E-01 2.54E-02 1.05E-01
Aortic stenosis BB70 Calcified aortic valve 5.90E-01 -2.11E-02 -4.83E-02
Apnea 7A40 Hyperplastic tonsil 1.15E-01 3.21E-01 1.62E+00
Arthropathy FA00-FA5Z Peripheral blood 2.03E-01 7.75E-02 6.61E-01
Asthma CA23 Nasal and bronchial airway 9.67E-01 -1.59E-03 -2.88E-03
Atopic dermatitis EA80 Skin 1.38E-01 1.53E-02 8.88E-02
Autism 6A02 Whole blood 1.37E-01 1.49E-01 6.10E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.08E-02 -2.49E-01 -1.38E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.28E-03 8.61E-01 3.58E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.93E-06 1.35E-01 4.80E-01
Batten disease 5C56.1 Whole blood 3.32E-02 3.47E-02 3.77E-01
Behcet's disease 4A62 Peripheral blood 5.48E-01 1.83E-02 9.15E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.43E-03 8.64E-02 5.79E-01
Bladder cancer 2C94 Bladder tissue 2.64E-01 5.34E-02 3.44E-01
Breast cancer 2C60-2C6Z Breast tissue 3.71E-07 1.35E-01 3.28E-01
Cardioembolic stroke 8B11.20 Whole blood 2.21E-01 2.20E-02 1.81E-01
Cervical cancer 2C77 Cervical tissue 8.30E-03 3.13E-01 1.03E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.06E-01 -1.14E-01 -4.71E-01
Chronic hepatitis C 1E51.1 Whole blood 4.94E-01 -6.92E-02 -7.16E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.78E-02 -4.24E-02 -1.87E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.50E-06 2.13E-01 1.14E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.61E-01 -2.75E-02 -1.25E-01
Colon cancer 2B90 Colon tissue 1.94E-05 -7.18E-02 -3.41E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.07E-01 -1.01E-01 -3.66E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.51E-01 1.17E-02 5.70E-02
Endometriosis GA10 Endometrium tissue 1.20E-04 -3.73E-01 -7.75E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.30E-01 -1.18E-01 -1.10E+00
Familial hypercholesterolemia 5C80.00 Whole blood 2.26E-06 5.03E-01 1.72E+00
Gastric cancer 2B72 Gastric tissue 8.79E-01 -1.98E-01 -4.16E-01
Glioblastopma 2A00.00 Nervous tissue 1.29E-113 5.07E-01 1.65E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.93E-01 -2.26E-02 -6.46E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.52E-01 5.17E-02 1.59E-01
Head and neck cancer 2D42 Head and neck tissue 1.25E-04 -9.08E-02 -4.34E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.29E-02 1.82E-01 4.77E-01
Huntington's disease 8A01.10 Whole blood 1.37E-01 -1.19E-01 -8.57E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.64E-03 2.30E-01 2.37E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.69E-01 -3.15E-02 -4.07E-01
Influenza 1E30 Whole blood 9.35E-02 1.17E-01 1.70E+00
Interstitial cystitis GC00.3 Bladder tissue 7.86E-02 9.65E-02 1.18E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.90E-03 3.83E-01 1.50E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.00E-02 -9.43E-02 -3.73E-01
Ischemic stroke 8B11 Peripheral blood 5.07E-01 8.75E-02 4.97E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.56E-10 -2.86E-01 -1.27E+00
Lateral sclerosis 8B60.4 Skin 9.42E-01 -7.31E-02 -3.24E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.22E-01 -1.93E-01 -3.20E-01
Liver cancer 2C12.0 Liver tissue 3.38E-11 -2.87E-01 -1.39E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.49E-01 -5.68E-02 -2.54E-01
Lung cancer 2C25 Lung tissue 5.66E-06 7.32E-02 3.06E-01
Lupus erythematosus 4A40 Whole blood 2.45E-02 1.05E-01 2.01E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.10E-01 3.46E-02 2.42E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.31E-01 1.29E-02 4.86E-02
Melanoma 2C30 Skin 1.78E-01 1.85E-01 2.97E-01
Multiple myeloma 2A83.1 Peripheral blood 3.47E-01 -7.14E-02 -3.96E-01
Multiple myeloma 2A83.1 Bone marrow 4.18E-04 6.27E-01 2.33E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.42E-01 -1.20E-01 -1.28E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.49E-01 -3.91E-02 -2.58E-01
Myelofibrosis 2A20.2 Whole blood 1.97E-01 8.95E-02 7.48E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.79E-01 1.04E-01 2.50E-01
Myopathy 8C70.6 Muscle tissue 9.02E-06 2.62E-01 3.21E+00
Neonatal sepsis KA60 Whole blood 2.25E-13 3.35E-01 1.19E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.64E-07 7.60E-01 3.92E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.21E-01 -1.07E-01 -3.50E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.09E-01 8.57E-02 4.42E-01
Olive pollen allergy CA08.00 Peripheral blood 2.29E-01 1.97E-01 1.41E+00
Oral cancer 2B6E Oral tissue 8.08E-01 -1.24E-01 -4.09E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.49E-01 2.64E-01 5.39E-01
Osteoporosis FB83.1 Bone marrow 7.78E-01 -6.14E-02 -1.03E+00
Ovarian cancer 2C73 Ovarian tissue 1.53E-01 9.79E-02 4.88E-01
Pancreatic cancer 2C10 Pancreas 1.96E-01 -9.29E-03 -4.74E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 9.86E-02 1.14E-01 1.17E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.32E-02 1.14E-01 8.10E-01
Pituitary cancer 2D12 Pituitary tissue 1.42E-01 2.00E-02 1.29E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.67E-01 -6.36E-02 -4.30E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.76E-01 6.67E-02 3.66E-01
Polycythemia vera 2A20.4 Whole blood 7.41E-01 1.65E-03 1.32E-02
Pompe disease 5C51.3 Biceps muscle 3.72E-03 3.31E-01 1.72E+00
Preterm birth KA21.4Z Myometrium 2.40E-01 -2.49E-01 -8.10E-01
Prostate cancer 2C82 Prostate 1.74E-07 1.16E+00 2.02E+00
Psoriasis EA90 Skin 9.06E-08 2.38E-01 7.95E-01
Rectal cancer 2B92 Rectal colon tissue 1.18E-02 -2.75E-01 -1.34E+00
Renal cancer 2C90-2C91 Kidney 7.36E-03 2.30E-01 1.21E+00
Retinoblastoma 2D02.2 Uvea 4.36E-07 6.15E-01 2.91E+00
Rheumatoid arthritis FA20 Synovial tissue 2.01E-01 -3.48E-01 -7.74E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.56E-01 -4.95E-02 -3.12E-01
Schizophrenia 6A20 Prefrontal cortex 1.15E-01 9.58E-02 1.69E-01
Schizophrenia 6A20 Superior temporal cortex 6.51E-01 1.34E-02 8.56E-02
Scleroderma 4A42.Z Whole blood 3.04E-11 3.86E-01 5.83E+00
Seizure 8A60-8A6Z Whole blood 2.70E-01 -1.34E-01 -8.70E-01
Sensitive skin EK0Z Skin 3.65E-01 4.27E-02 2.41E-01
Sepsis with septic shock 1G41 Whole blood 1.62E-13 1.85E-01 7.24E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.45E-02 -2.62E-01 -9.36E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.21E-01 5.48E-02 3.86E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.21E-01 2.67E-02 1.50E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.56E-01 1.64E-01 8.18E-01
Skin cancer 2C30-2C3Z Skin 1.76E-17 4.15E-01 8.43E-01
Thrombocythemia 3B63 Whole blood 9.57E-01 1.92E-02 1.47E-01
Thrombocytopenia 3B64 Whole blood 2.68E-01 2.55E-01 3.35E-01
Thyroid cancer 2D10 Thyroid 1.80E-01 -5.98E-04 -3.15E-03
Tibial muscular dystrophy 8C75 Muscle tissue 1.25E-03 2.51E-01 9.31E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.94E-02 3.42E-01 3.00E+00
Type 2 diabetes 5A11 Liver tissue 3.49E-01 -2.68E-02 -2.00E-01
Ureter cancer 2C92 Urothelium 9.42E-01 -1.03E-01 -2.67E-01
Uterine cancer 2C78 Endometrium tissue 3.31E-05 -1.48E-01 -2.87E-01
Vitiligo ED63.0 Skin 4.61E-01 -4.29E-02 -1.78E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Beta-glucuronidase (GUSB) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vestronidase alfa DM4UHZF Mucopolysaccharidosis 5C56.3 Approved [1]
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PerioPatch DMFM6OU Periodontal disease DA0C Phase 2 [2]

References

1 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
2 Clinical pipeline report, company report or official report of Izun Pharmaceuticals.
3 MFN human ref: Chondroitin sulfate degradation.
4 Summary of FDA-approved anticancer cytotoxic drugs at May 2019.
5 Foreign Compound Metabolism in Mammals. Edited by D. E. Hathway.