Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER5U19)

DME Name Bifunctional epoxide hydrolase 2 (EPHX2)
Synonyms Lipid-phosphate phosphatase; Soluble epoxide hydrolase; Cytosolic epoxide hydrolase 2; CEH2; EPHX2; SEH
Gene Name EPHX2
UniProt ID
HYES_HUMAN
INTEDE ID
DME0389
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2053
EC Number EC: 3.3.2.10
Hydrolases
Ether hydrolase
Ether hydrolase
EC: 3.3.2.10
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Function
This enzyme has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides and plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Besides, it also determines steady- state levels of physiological mediators Additionally, the N-terminal domain has lipid phosphatase activity, with the highest activity towards threo-9,10- phosphonooxy-hydroxy-octadecanoic acid, followed by erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy-octadec-9Z-enoic acid and 12-phosphonooxy-octadec-9E-enoic acid.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Peroxisome (hsa04146 )
Reactome Pathway
Peroxisomal protein import (R-HSA-9033241 )
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 )
Biosynthesis of maresins (R-HSA-9018682 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Myrisglycerol-phosphate DMVMHTC N. A. N. A. Investigative [19]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.13E-21 -4.03E-01 -1.19E+00
Alopecia ED70 Skin from scalp 9.38E-01 -2.14E-02 -8.33E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.80E-01 1.52E-01 3.52E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.54E-01 -7.67E-02 -5.67E-01
Aortic stenosis BB70 Calcified aortic valve 2.50E-01 -7.67E-01 -7.31E-01
Apnea 7A40 Hyperplastic tonsil 7.75E-01 8.05E-03 9.74E-03
Arthropathy FA00-FA5Z Peripheral blood 7.33E-02 -5.09E-01 -1.18E+00
Asthma CA23 Nasal and bronchial airway 2.83E-03 1.74E-01 2.09E-01
Atopic dermatitis EA80 Skin 6.41E-10 -5.33E-01 -2.44E+00
Autism 6A02 Whole blood 5.14E-01 -3.53E-02 -1.11E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.09E-01 -8.99E-02 -5.88E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.37E-02 -1.46E-01 -5.80E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.50E-10 -4.88E-01 -9.48E-01
Batten disease 5C56.1 Whole blood 2.12E-01 -4.91E-01 -2.14E+00
Behcet's disease 4A62 Peripheral blood 6.05E-01 2.39E-01 5.60E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.34E-01 -2.29E-02 -1.05E-01
Bladder cancer 2C94 Bladder tissue 9.04E-07 -2.28E+00 -5.77E+00
Breast cancer 2C60-2C6Z Breast tissue 4.64E-65 -8.86E-01 -1.64E+00
Cardioembolic stroke 8B11.20 Whole blood 7.19E-09 -7.87E-01 -1.57E+00
Cervical cancer 2C77 Cervical tissue 1.84E-06 -1.02E+00 -1.69E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.31E-01 6.37E-02 6.38E-02
Chronic hepatitis C 1E51.1 Whole blood 5.21E-01 -1.38E-01 -2.67E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.78E-01 -1.03E-01 -2.69E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.40E-02 -1.81E-01 -4.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.35E-03 -4.73E-01 -1.06E+00
Colon cancer 2B90 Colon tissue 1.08E-126 -1.82E+00 -3.99E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.30E-01 -6.87E-02 -3.27E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.07E-01 1.04E-01 4.93E-01
Endometriosis GA10 Endometrium tissue 2.78E-01 -5.91E-01 -7.31E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.02E-01 -9.03E-02 -1.80E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.34E-11 -9.43E-01 -1.47E+00
Gastric cancer 2B72 Gastric tissue 9.77E-01 1.86E-01 6.19E-01
Glioblastopma 2A00.00 Nervous tissue 2.24E-07 8.44E-02 1.66E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.02E-01 -8.50E-02 -7.12E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.01E-02 -7.81E-01 -1.33E+00
Head and neck cancer 2D42 Head and neck tissue 1.12E-63 -2.05E+00 -4.09E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.58E-01 2.44E-02 7.49E-02
Huntington's disease 8A01.10 Whole blood 2.18E-01 2.32E-01 4.95E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.47E-02 8.02E-01 1.71E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.28E-02 -4.34E-01 -1.30E+00
Influenza 1E30 Whole blood 3.58E-01 -6.95E-03 -1.62E-01
Interstitial cystitis GC00.3 Bladder tissue 1.35E-04 -1.07E+00 -5.19E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.95E-06 -1.10E+00 -3.84E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.44E-02 -1.65E-01 -3.96E-01
Ischemic stroke 8B11 Peripheral blood 8.58E-01 4.47E-02 8.16E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.35E-10 -4.93E-01 -1.03E+00
Lateral sclerosis 8B60.4 Skin 4.31E-01 -1.33E-01 -3.26E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.12E-01 -1.80E-01 -5.73E-01
Liver cancer 2C12.0 Liver tissue 3.30E-19 -1.90E+00 -2.39E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.01E-03 -2.61E+00 -6.39E+00
Lung cancer 2C25 Lung tissue 1.74E-30 -7.39E-01 -1.48E+00
Lupus erythematosus 4A40 Whole blood 1.83E-04 -3.07E-01 -4.27E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.35E-01 -1.10E-02 -4.82E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.43E-01 -1.34E-01 -2.45E-01
Melanoma 2C30 Skin 6.35E-04 -1.72E+00 -1.34E+00
Multiple myeloma 2A83.1 Peripheral blood 4.66E-01 5.04E-02 2.96E-01
Multiple myeloma 2A83.1 Bone marrow 9.01E-06 7.51E-01 2.72E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.16E-01 2.96E-01 1.46E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.36E-01 2.67E-01 5.96E-01
Myelofibrosis 2A20.2 Whole blood 1.21E-03 -4.72E-01 -2.36E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.36E-01 -2.61E-01 -2.99E-01
Myopathy 8C70.6 Muscle tissue 9.53E-01 1.01E-02 4.81E-02
Neonatal sepsis KA60 Whole blood 2.74E-33 -1.13E+00 -2.16E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.92E-01 -2.83E-02 -7.73E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 5.39E-01 -6.56E-03 -1.11E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.30E-01 -1.27E-01 -8.70E-01
Olive pollen allergy CA08.00 Peripheral blood 7.63E-01 3.21E-02 1.14E-01
Oral cancer 2B6E Oral tissue 3.49E-11 -1.54E+00 -2.38E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.43E-01 -2.89E-01 -4.17E-01
Osteoporosis FB83.1 Bone marrow 5.03E-02 3.61E-01 1.03E+00
Ovarian cancer 2C73 Ovarian tissue 4.38E-02 -8.19E-01 -1.04E+00
Pancreatic cancer 2C10 Pancreas 8.87E-04 -1.18E+00 -1.49E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.21E-01 -2.36E-01 -5.15E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.41E-02 -5.06E-01 -1.14E+00
Pituitary cancer 2D12 Pituitary tissue 4.80E-01 4.20E-01 8.05E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.33E-02 4.87E-01 9.94E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.07E-01 1.25E-02 5.10E-02
Polycythemia vera 2A20.4 Whole blood 5.79E-15 -3.98E-01 -2.28E+00
Pompe disease 5C51.3 Biceps muscle 2.24E-01 -4.11E-01 -7.41E-01
Preterm birth KA21.4Z Myometrium 5.01E-02 4.76E-01 1.51E+00
Prostate cancer 2C82 Prostate 2.76E-01 -2.08E-01 -1.95E-01
Psoriasis EA90 Skin 3.38E-04 -3.39E-01 -6.29E-01
Rectal cancer 2B92 Rectal colon tissue 6.21E-15 -1.71E+00 -9.42E+00
Renal cancer 2C90-2C91 Kidney 3.58E-05 -1.34E+00 -1.87E+00
Retinoblastoma 2D02.2 Uvea 9.29E-01 1.86E-01 7.38E-01
Rheumatoid arthritis FA20 Synovial tissue 1.28E-02 6.03E-01 1.40E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.93E-01 7.32E-02 2.44E-01
Schizophrenia 6A20 Prefrontal cortex 1.27E-01 1.65E-01 2.87E-01
Schizophrenia 6A20 Superior temporal cortex 6.89E-01 2.05E-02 1.18E-01
Scleroderma 4A42.Z Whole blood 2.11E-01 -2.21E-01 -4.80E-01
Seizure 8A60-8A6Z Whole blood 8.28E-01 1.78E-01 2.74E-01
Sensitive skin EK0Z Skin 4.20E-01 -1.61E-01 -1.15E+00
Sepsis with septic shock 1G41 Whole blood 8.82E-70 -1.16E+00 -2.39E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.59E-01 -2.15E-01 -4.29E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.97E-03 1.51E-01 1.08E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.31E-01 2.40E-01 3.15E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.20E-01 -7.17E-02 -2.71E-01
Skin cancer 2C30-2C3Z Skin 7.34E-129 -2.01E+00 -4.20E+00
Thrombocythemia 3B63 Whole blood 4.01E-07 -3.59E-01 -1.78E+00
Thrombocytopenia 3B64 Whole blood 4.84E-01 2.53E-01 1.97E-01
Thyroid cancer 2D10 Thyroid 1.31E-33 -7.41E-01 -2.02E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.34E-01 -3.08E-01 -1.07E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.33E-01 -1.30E-01 -4.74E-01
Type 2 diabetes 5A11 Liver tissue 4.31E-01 -2.84E-01 -1.23E+00
Ureter cancer 2C92 Urothelium 9.97E-01 -1.16E-02 -6.78E-02
Uterine cancer 2C78 Endometrium tissue 1.05E-03 -3.96E-01 -4.62E-01
Vitiligo ED63.0 Skin 4.60E-01 -1.93E-01 -4.83E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Soluble epoxide hydrolase (EPHX2) DTT Info
DME DTT Type Clinical trial
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AR9281 DMJHA6Q Hypertension BA00-BA04 Phase 2 [1]
GSK2256294 DM7FN12 Chronic obstructive pulmonary disease CA22 Phase 1 [2]
104 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,3-DIPHENYLUREA DMI4H05 Discovery agent N.A. Investigative [3]
1-(1-Adamantyl)-3-(1-propionylpiperidin-4-yl)urea DM7G2AB Discovery agent N.A. Investigative [4]
1-(1-Propionylpiperidin-4-yl)-3-m-tolylurea DMAZR9C Discovery agent N.A. Investigative [4]
1-(1-Propionylpiperidin-4-yl)-3-o-tolylurea DMUH59X Discovery agent N.A. Investigative [4]
1-(1-Propionylpiperidin-4-yl)-3-p-tolylurea DMWUBI4 Discovery agent N.A. Investigative [4]
1-(3-(3-morpholinopropoxy)phenyl)-3-phenylurea DM3EBFS Discovery agent N.A. Investigative [5]
1-(3-Chloro-phenyl)-3-(4-hydroxy-decyl)-urea DMC5PI4 Discovery agent N.A. Investigative [6]
1-(3-Chloro-phenyl)-3-cyclohexyl-urea DM1VLMC Discovery agent N.A. Investigative [6]
1-(4-(3-morpholinopropoxy)phenyl)-3-phenylurea DMYIK9W Discovery agent N.A. Investigative [5]
1-adamantan-1-yl-3-((R)-1-phenyl-ethyl)-urea DMRJSG7 Discovery agent N.A. Investigative [7]
1-adamantan-1-yl-3-(1-benzyl-piperidin-4-yl)-urea DMNXU1O Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-(1-butyl-piperidin-4-yl)-urea DMAJC42 Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-(1-ethyl-piperidin-4-yl)-urea DMY1Z2X Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-(1-propyl-piperidin-4-yl)-urea DM2K7TX Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-(2-heptyloxyethyl)urea DMRIYX9 Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-(2-hydroxy-phenyl)-urea DMJ8ZS6 Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-(2-hydroxyethyl)urea DMDO9YM Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-(2-methoxy-phenyl)-urea DMRBVFO Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-(3-hexyloxypropyl)urea DMGEXOZ Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-(3-hydroxy-phenyl)-urea DM8SEJP Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-(3-hydroxypropyl)urea DMZX72E Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-(3-methoxy-phenyl)-urea DMHAS3G Discovery agent N.A. Investigative [10]
1-Adamantan-1-yl-3-(4-hydroxy-decyl)-urea DMHKG89 Discovery agent N.A. Investigative [6]
1-Adamantan-1-yl-3-(4-hydroxy-phenyl)-urea DMUPAR1 Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-(4-hydroxybutyl)urea DM53G1V Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-(4-methoxy-phenyl)-urea DMMBYOD Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-(4-pentyloxybutyl)urea DM3RE2D Discovery agent N.A. Investigative [9]
1-adamantan-1-yl-3-(4-pentyloxycylclohexyl)urea DMUZ3OS Discovery agent N.A. Investigative [9]
1-adamantan-1-yl-3-(5-butoxypentyl)urea DMEDQVX Discovery agent N.A. Investigative [9]
1-adamantan-1-yl-3-(5-hydroxypentyl)urea DMV6824 Discovery agent N.A. Investigative [9]
1-adamantan-1-yl-3-(6-hydroxyhexyl)urea DMOX5MC Discovery agent N.A. Investigative [9]
1-adamantan-1-yl-3-(6-propyloxyhexyl)urea DMO1L3I Discovery agent N.A. Investigative [9]
1-Adamantan-1-yl-3-decyl-urea DMLD2G3 Discovery agent N.A. Investigative [6]
1-Adamantan-1-yl-3-phenyl-urea DMCFKX0 Discovery agent N.A. Investigative [10]
1-adamantan-1-yl-3-piperidin-4-yl-urea DMTNPBH Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-piperidin-4-ylmethyl-urea DMGPIL0 Discovery agent N.A. Investigative [8]
1-adamantan-1-yl-3-[4-(4-fluorophenoxy)butyl]urea DMXRHKQ Discovery agent N.A. Investigative [1]
1-Cycloheptyl-3-(1-propionylpiperidin-4-yl)urea DMA2607 Discovery agent N.A. Investigative [4]
1-Cyclohexyl-3-(1-propionylpiperidin-4-yl)urea DMAZYCD Discovery agent N.A. Investigative [4]
1-Cyclohexyl-3-(4-methoxy-phenyl)-urea DMESUD7 Discovery agent N.A. Investigative [6]
1-Cyclohexyl-3-phenethyl-urea DMH9O6V Discovery agent N.A. Investigative [6]
1-Cyclohexyl-3-phenyl-urea DM9K8HA Discovery agent N.A. Investigative [6]
1-Octyl-3-(1-propionylpiperidin-4-yl)urea DM9OJ7T Discovery agent N.A. Investigative [4]
1-Phenyl-3-(1-propionylpiperidin-4-yl)urea DMCHOFK Discovery agent N.A. Investigative [4]
12-(3-Adamantan-1-yl-ureido)-dodeca noic acid DM84YCI Discovery agent N.A. Investigative [11]
12-(3-n-Hexylureido)dodec-8(Z)-enoic acid DM0F3SR Discovery agent N.A. Investigative [12]
12-(3-n-Pentylureidooxy)dodec-8(Z)-enoic acid DMAFNXZ Discovery agent N.A. Investigative [12]
13-(3-n-Pentylthioureido)tridec-8(Z)-enoic Acid DMIY9DB Discovery agent N.A. Investigative [12]
13-(3-n-Pentylureido)tridec-5(Z)-enoic acid DM0NRJG Discovery agent N.A. Investigative [12]
13-(3-n-Pentylureido)tridec-8(E)-enoic acid DM17DY6 Discovery agent N.A. Investigative [12]
13-(3-n-Pentylureido)tridec-8-ynoic acid DM9VDOG Discovery agent N.A. Investigative [12]
13-(3-Pentyluredo)tridec-8(Z)-enoic acid DM3I6PS Discovery agent N.A. Investigative [12]
13-(5-n-Pentylfuran-2-yl)tridec-8(Z)-enoic acid DM8HRTC Discovery agent N.A. Investigative [12]
13-(N-Isopropylheptanamido)tridec-8(Z)-enoic acid DMXK6D2 Discovery agent N.A. Investigative [12]
13-(N-Methyl-n-heptnamido)tridec-8(Z)-enoic acid DM689TH Discovery agent N.A. Investigative [12]
13-(n-Pentylcarbamoyloxy)tridec-8(Z)-enoic acid DMSF3C8 Discovery agent N.A. Investigative [12]
13-n-Heptanamidotridec-5-ynoic acid DMRVQCB Discovery agent N.A. Investigative [12]
13-n-Heptanamidotridec-8(Z)-enoic acid DM0LGWJ Discovery agent N.A. Investigative [12]
14-(n-Hexylamino)-14-oxotetradec-8(Z)-enoic acid DM5NFB6 Discovery agent N.A. Investigative [12]
16-(3-Ethylureido)hexadec-11(Z)-enoic acid DMCHMNF Discovery agent N.A. Investigative [12]
2-Adamantan-1-yl-N-decyl-acetamide DMJAUH0 Discovery agent N.A. Investigative [6]
2-Cyclohexyl-N-(4-methoxy-phenyl)-acetamide DMF6PMU Discovery agent N.A. Investigative [6]
2-Cyclohexyl-N-phenethyl-acetamide DM89CLH Discovery agent N.A. Investigative [6]
2-Cyclohexyl-N-phenyl-acetamide DMBJUP5 Discovery agent N.A. Investigative [6]
3-(3-Adamantan-1-yl-ureido)-benzoic acid DMT0M94 Discovery agent N.A. Investigative [10]
4,4-Diphenyl-N-(pyridin-3-yl)-butyramide DMM0H9Y Discovery agent N.A. Investigative [13]
4-(3-Adamantan-1-yl-ureido)-benzoic acid DMKUAEY Discovery agent N.A. Investigative [10]
4-(3-cyclohexylureido)butanoic acid DMXFLMK Discovery agent N.A. Investigative [3]
6-amino-N-(2,4-dichlorobenzyl)nicotinamide DMEHG2F Discovery agent N.A. Investigative [14]
6-amino-N-(3,3-diphenylpropyl)nicotinamide DMYI5GU Discovery agent N.A. Investigative [14]
6-{[(CYCLOHEXYLAMINO)CARBONYL]AMINO}HEXANOIC ACID DM1G7P9 Discovery agent N.A. Investigative [3]
9-(3-n-Pentylureido)non-4(Z)-enoic acid DMUIRS1 Discovery agent N.A. Investigative [12]
9-(3-n-Pentylureido)non-4-ynoic acid DMJYMFE Discovery agent N.A. Investigative [12]
Cis-1-adamantan-1-yl-3-(4-hydroxycyclohexyl)urea DMP3F0D Discovery agent N.A. Investigative [1]
Cis-1-adamantan-1-yl-3-(4-methoxycyclohexyl)urea DM8NX3Q Discovery agent N.A. Investigative [1]
Dodecanoic acid adamantan-1-ylamide DM6TIQX Discovery agent N.A. Investigative [6]
EXRD-4605 DMY96KO Hypertension BA00-BA04 Investigative [15]
Methyl 14-(3-n-butylureido)tetradec-8(Z)-enoate DMV1AL5 Discovery agent N.A. Investigative [12]
Methyl 4-(3-cyclohexylureido)butanoate DM9S210 Discovery agent N.A. Investigative [16]
Methyl 6-(3-cyclohexylureido)hexanoate DM9BPQ1 Discovery agent N.A. Investigative [16]
N,N'-dicyclohexyl-urea DMLVMJH Discovery agent N.A. Investigative [1]
N-(3,3-Diphenyl-propyl)-2-pyridine-3-ylacetamide DM4PTR3 Discovery agent N.A. Investigative [13]
N-(3,3-Diphenyl-propyl)-isonicotinamide DMOXR4K Discovery agent N.A. Investigative [13]
N-(3,3-diphenyl-propyl)-nicotinamide DMDYZ9K Discovery agent N.A. Investigative [13]
N-(3-Chloro-phenyl)-2-cyclohexyl-acetamide DME6IKT Discovery agent N.A. Investigative [6]
N-(3-Phenyl-propyl)-nicotinamide DMA7X62 Discovery agent N.A. Investigative [13]
N-(4,4-Diphenyl-butyl)-nicotinamide DM086VJ Discovery agent N.A. Investigative [13]
N-(biphenyl-3-yl)benzo[d]isoxazol-3-amine DM2ZQBS Discovery agent N.A. Investigative [17]
N-(biphenyl-4-yl)benzo[d]isoxazol-3-amine DML10NT Discovery agent N.A. Investigative [17]
N-(naphthalen-1-yl)benzo[d]isoxazol-3-amine DM2CBNG Discovery agent N.A. Investigative [17]
N-(naphthalen-2-yl)benzo[d]isoxazol-3-amine DM2NHVX Discovery agent N.A. Investigative [17]
N-adamantyl-N'-cyclohexylurea DMZ43N1 Discovery agent N.A. Investigative [1]
N-benzyl-6-(3,3,3-trifluoropropoxy)nicotinamide DM7NHRV Discovery agent N.A. Investigative [14]
N-Cyclohexyl-2-(4-methoxy-phenyl)-acetamide DM8HS0B Discovery agent N.A. Investigative [6]
N-Cyclohexyl-2-phenyl-acetamide DM15MQT Discovery agent N.A. Investigative [6]
N-Cyclohexyl-4-phenyl-butyramide DM2COR5 Discovery agent N.A. Investigative [6]
N-Cyclohexyl-N'-(4-Iodophenyl)Urea DMPSYRW Discovery agent N.A. Investigative [18]
N-Cyclohexyl-N'-(Propyl)Phenyl Urea DMYF243 Discovery agent N.A. Investigative [3]
N-Cyclohexyl-N'-Decylurea DM17G82 Discovery agent N.A. Investigative [3]
N-[(CYCLOHEXYLAMINO)CARBONYL]GLYCINE DMHNR36 Discovery agent N.A. Investigative [3]
N-[3,3-Bis-(4-fluorophenyl)-propyl]-benzamide DMKPYEU Discovery agent N.A. Investigative [13]
N-[3,3-Bis-(4-fluorophenyl)-propyl]-nicotinamide DMIP8AK Discovery agent N.A. Investigative [13]
Trans,trans-1,3-bis-(4-hydroxycyclohexyl)urea DMHD1XM Discovery agent N.A. Investigative [1]
[4-(3-Adamantan-1-yl-ureido)-phenyl]-acetic acid DMNCAE9 Discovery agent N.A. Investigative [10]
⏷ Show the Full List of 104 Investigative Drug(s)

References

1 Orally bioavailable potent soluble epoxide hydrolase inhibitors. J Med Chem. 2007 Aug 9;50(16):3825-40.
2 In vitro and in vivo characterization of a novel soluble epoxide hydrolase inhibitor. Prostaglandins Other Lipid Mediat. 2013 Jul-Aug;104-105:25-31.
3 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
4 1-Aryl-3-(1-acylpiperidin-4-yl)urea inhibitors of human and murine soluble epoxide hydrolase: structure-activity relationships, pharmacokinetics, a... J Med Chem. 2010 Oct 14;53(19):7067-75.
5 Unsymmetrical non-adamantyl N,N'-diaryl urea and amide inhibitors of soluble expoxide hydrolase. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4259-63.
6 Optimization of amide-based inhibitors of soluble epoxide hydrolase with improved water solubility. J Med Chem. 2005 May 19;48(10):3621-9.
7 Solid-phase combinatorial approach for the optimization of soluble epoxide hydrolase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5773-7.
8 Synthesis and SAR of conformationally restricted inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5212-6.
9 1,3-disubstituted ureas functionalized with ether groups are potent inhibitors of the soluble epoxide hydrolase with improved pharmacokinetic prope... J Med Chem. 2007 Oct 18;50(21):5217-26.
10 Salicylate-urea-based soluble epoxide hydrolase inhibitors with high metabolic and chemical stabilities. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1784-9.
11 Discovery of a highly potent, selective, and bioavailable soluble epoxide hydrolase inhibitor with excellent ex vivo target engagement. J Med Chem. 2009 Aug 27;52(16):5009-12.
12 14,15-Epoxyeicosa-5,8,11-trienoic acid (14,15-EET) surrogates containing epoxide bioisosteres: influence upon vascular relaxation and soluble epoxi... J Med Chem. 2009 Aug 27;52(16):5069-75.
13 Structure-based optimization of arylamides as inhibitors of soluble epoxide hydrolase. J Med Chem. 2009 Oct 8;52(19):5880-95.
14 Design and synthesis of substituted nicotinamides as inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett. 2009 Oct 15;19(20):5864-8.
15 Soluble epoxide hydrolase inhibition does not prevent cardiac remodeling and dysfunction after aortic constriction in rats and mice. J Cardiovasc Pharmacol. 2013 Apr;61(4):291-301.
16 Peptidyl-urea based inhibitors of soluble epoxide hydrolases. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5439-44.
17 A strategy of employing aminoheterocycles as amide mimics to identify novel, potent and bioavailable soluble epoxide hydrolase inhibitors. Bioorg Med Chem Lett. 2009 Oct 1;19(19):5716-21.
18 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
19 Role of soluble epoxide hydrolase phosphatase activity in the metabolism of lysophosphatidic acids. Biochem Biophys Res Commun. 2012 Mar 23;419(4):796-800.