Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERDQWN)

DME Name Dihydrotestosterone oxidoreductase (HSD3B1)
Synonyms
Delta-5-3-ketosteroid isomerase; Steroid Delta-isomerase; Trophoblast antigen FDO161G; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-hydroxysteroid 3-dehydrogenase; 3-beta-HSD I; 3BH; HSD3B1; HSDB3A
Gene Name HSD3B1
UniProt ID
3BHS1_HUMAN
INTEDE ID
DME0221
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3283
EC Number EC: 1.1.1.145
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.145
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLE
GDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVF
IYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTL
YTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRAL
QDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEI
VSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSL
VDRHKETLKSKTQ
Function
This enzyme is responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo- Delta(4)-steroids. It specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, it catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. And it specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR and converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone.
KEGG Pathway
Aldosterone synthesis and secretion (hsa04925 )
Cortisol synthesis and secretion (hsa04927 )
Cushing syndrome (hsa04934 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucocorticoid biosynthesis (R-HSA-194002 )
Mineralocorticoid biosynthesis (R-HSA-193993 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [1]
Tibolone DM78XFG Anabolic metabolism 5C50-5C8Z Approved [2]
Pregnenolone DM6VFO1 Schizophrenia 6A20 Phase 4 [3]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
HE2100 DMCP2KH Thrombocytopenia 3B64 Discontinued in Phase 1 [4]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
17alpha-hydroxypregnenolone DMT2EPG Discovery agent N.A. Investigative [3]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
17alpha-hydroxypregnenolone Discovery agent [N.A.] Investigative Km = 0.0035 microM [3]
Pregnenolone Schizophrenia [6A20] Phase 4 Km = 0.0028 microM [3]
Prasterone Chronic obstructive pulmonary disease [CA22] Approved Km = 0.00164 microM [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.96E-01 1.96E-03 1.58E-02
Alopecia ED70 Skin from scalp 5.77E-02 3.26E-01 3.81E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.19E-01 -3.04E-02 -2.43E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.50E-01 -1.85E-02 -1.69E-01
Aortic stenosis BB70 Calcified aortic valve 8.27E-01 -9.50E-03 -2.46E-02
Apnea 7A40 Hyperplastic tonsil 3.00E-01 -6.01E-02 -6.05E-01
Arthropathy FA00-FA5Z Peripheral blood 1.10E-01 5.53E-02 6.89E-01
Asthma CA23 Nasal and bronchial airway 7.48E-02 -6.14E-02 -4.02E-01
Atopic dermatitis EA80 Skin 9.24E-01 -1.30E-01 -1.19E-01
Autism 6A02 Whole blood 4.82E-01 -1.61E-02 -1.16E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.42E-01 -2.41E-02 -1.66E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.99E-01 -2.40E-02 -1.52E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.16E-01 -3.52E-03 -1.53E-02
Batten disease 5C56.1 Whole blood 1.26E-01 -6.28E-03 -1.03E-01
Behcet's disease 4A62 Peripheral blood 6.29E-01 1.59E-02 1.28E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.17E-01 -5.00E-02 -5.42E-01
Bladder cancer 2C94 Bladder tissue 8.47E-09 4.84E-01 3.65E+00
Breast cancer 2C60-2C6Z Breast tissue 2.82E-13 -1.63E-01 -4.26E-01
Cardioembolic stroke 8B11.20 Whole blood 4.74E-02 6.95E-02 4.71E-01
Cervical cancer 2C77 Cervical tissue 1.31E-01 -5.91E-02 -2.49E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.88E-01 5.54E-02 3.60E-01
Chronic hepatitis C 1E51.1 Whole blood 6.21E-02 1.53E-01 1.14E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 6.64E-03 8.78E-02 6.96E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.20E-01 1.07E-02 1.03E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.25E-01 4.08E-04 3.45E-03
Colon cancer 2B90 Colon tissue 4.07E-02 -8.92E-02 -2.45E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.56E-01 7.35E-02 4.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.69E-01 -6.31E-02 -6.04E-01
Endometriosis GA10 Endometrium tissue 4.43E-02 1.13E-01 6.55E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.24E-01 2.00E-02 1.89E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.37E-04 -1.62E-01 -1.11E+00
Gastric cancer 2B72 Gastric tissue 8.59E-01 -2.54E-02 -1.44E-01
Glioblastopma 2A00.00 Nervous tissue 3.74E-01 6.21E-03 3.21E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.76E-01 -3.55E-02 -1.63E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.30E-03 -2.35E-01 -1.69E+00
Head and neck cancer 2D42 Head and neck tissue 6.12E-01 2.10E-02 3.90E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.65E-01 -3.76E-02 -1.33E-01
Huntington's disease 8A01.10 Whole blood 6.00E-02 1.15E-01 1.55E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.99E-01 4.48E-02 3.04E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.33E-02 1.06E-01 1.21E+00
Influenza 1E30 Whole blood 1.01E-01 1.61E-01 1.51E+00
Interstitial cystitis GC00.3 Bladder tissue 1.16E-01 7.42E-02 1.65E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.12E-01 1.17E-01 6.83E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.56E-01 -8.52E-02 -3.77E-01
Ischemic stroke 8B11 Peripheral blood 9.10E-01 -2.73E-02 -2.09E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.56E-01 1.36E-02 7.20E-02
Lateral sclerosis 8B60.4 Skin 2.82E-01 4.24E-02 4.08E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.83E-01 -9.13E-02 -4.27E-01
Liver cancer 2C12.0 Liver tissue 5.15E-01 -7.33E-02 -2.40E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.30E-01 -1.36E-01 -3.15E-01
Lung cancer 2C25 Lung tissue 1.54E-03 2.68E-02 2.42E-01
Lupus erythematosus 4A40 Whole blood 1.47E-01 2.03E-02 9.20E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.14E-01 2.01E-02 2.55E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.19E-01 7.13E-03 3.56E-02
Melanoma 2C30 Skin 2.40E-05 -2.72E+00 -1.64E+00
Multiple myeloma 2A83.1 Peripheral blood 1.27E-02 1.35E-01 1.47E+00
Multiple myeloma 2A83.1 Bone marrow 6.87E-04 -2.97E-01 -1.62E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.74E-01 5.36E-02 4.46E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.37E-02 4.00E-02 3.18E-01
Myelofibrosis 2A20.2 Whole blood 4.31E-01 8.08E-03 9.91E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.25E-01 3.91E-02 1.30E-01
Myopathy 8C70.6 Muscle tissue 5.87E-01 -1.25E-02 -6.78E-02
Neonatal sepsis KA60 Whole blood 2.82E-01 -3.84E-02 -2.74E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.43E-02 -2.19E-01 -1.03E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.38E-02 -4.16E-02 -5.13E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.47E-01 4.01E-02 3.75E-01
Olive pollen allergy CA08.00 Peripheral blood 8.06E-02 1.02E-01 9.52E-01
Oral cancer 2B6E Oral tissue 1.24E-02 -2.57E-01 -1.04E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.44E-01 -2.89E-03 -1.56E-02
Osteoporosis FB83.1 Bone marrow 8.92E-01 6.12E-03 1.04E-01
Ovarian cancer 2C73 Ovarian tissue 8.24E-01 -1.46E-02 -5.85E-02
Pancreatic cancer 2C10 Pancreas 3.70E-02 -1.53E-01 -5.84E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.51E-01 -1.45E-03 -1.29E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.17E-01 -3.10E-02 -3.38E-01
Pituitary cancer 2D12 Pituitary tissue 2.52E-01 -4.20E-02 -3.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.29E-01 -7.46E-02 -4.92E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.91E-01 6.49E-03 7.09E-02
Polycythemia vera 2A20.4 Whole blood 7.89E-02 2.83E-02 3.13E-01
Pompe disease 5C51.3 Biceps muscle 9.72E-02 6.02E-02 8.40E-01
Preterm birth KA21.4Z Myometrium 4.03E-01 -9.61E-02 -9.98E-02
Prostate cancer 2C82 Prostate 4.54E-02 -1.54E-01 -4.81E-01
Psoriasis EA90 Skin 1.07E-15 -1.23E+00 -1.26E+00
Rectal cancer 2B92 Rectal colon tissue 7.75E-02 -2.30E-01 -1.36E+00
Renal cancer 2C90-2C91 Kidney 2.30E-01 -1.39E-01 -1.12E+00
Retinoblastoma 2D02.2 Uvea 8.64E-01 2.61E-02 2.88E-01
Rheumatoid arthritis FA20 Synovial tissue 2.86E-01 -9.48E-02 -5.01E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.69E-01 4.77E-03 5.29E-02
Schizophrenia 6A20 Prefrontal cortex 2.84E-01 -8.57E-03 -6.45E-02
Schizophrenia 6A20 Superior temporal cortex 7.78E-01 4.16E-03 5.82E-02
Scleroderma 4A42.Z Whole blood 4.05E-03 1.81E-01 1.87E+00
Seizure 8A60-8A6Z Whole blood 5.00E-01 -4.88E-02 -3.60E-01
Sensitive skin EK0Z Skin 6.30E-01 -1.87E-01 -4.70E-01
Sepsis with septic shock 1G41 Whole blood 8.25E-02 1.54E-02 9.26E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.28E-02 3.02E-01 1.57E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.49E-01 1.10E-02 7.03E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 1.87E-01 -9.54E-02 -7.02E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.20E-01 -4.84E-02 -1.62E-01
Skin cancer 2C30-2C3Z Skin 1.24E-36 -1.23E+00 -1.12E+00
Thrombocythemia 3B63 Whole blood 5.91E-01 2.72E-02 3.35E-01
Thrombocytopenia 3B64 Whole blood 8.45E-01 1.72E-02 1.11E-01
Thyroid cancer 2D10 Thyroid 1.09E-01 4.11E-02 2.52E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.08E-01 -9.14E-03 -6.31E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.26E-02 2.09E-01 1.94E+00
Type 2 diabetes 5A11 Liver tissue 1.05E-01 9.62E-02 1.05E+00
Ureter cancer 2C92 Urothelium 7.21E-01 -1.21E-02 -8.92E-02
Uterine cancer 2C78 Endometrium tissue 5.41E-02 8.09E-02 3.63E-01
Vitiligo ED63.0 Skin 5.97E-01 -4.31E-01 -3.85E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Selective inhibition of human 3beta-hydroxysteroid dehydrogenase type 1 as a potential treatment for breast cancer. J Steroid Biochem Mol Biol. 2011 May;125(1-2):57-65.
2 Tibolone: a unique version of hormone replacement therapy. Ann Pharmacother. 2004 May;38(5):874-81.
3 Structure/function relationships responsible for the kinetic differences between human type 1 and type 2 3beta-hydroxysteroid dehydrogenase and for the catalysis of the type 1 activity. J Biol Chem. 2002 Nov 8;277(45):42795-801.
4 Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.