Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERSX5P)

DME Name Cytochrome P450 2J2 (CYP2J2)
Synonyms Cytochrome P450 family 2 subfamily J member 2; Hydroperoxy icosatetraenoate isomerase; Arachidonic acid epoxygenase; Albendazole monooxygenase (hydroxylating); CYP2J2; CYPIIJ2
Gene Name CYP2J2
UniProt ID
CP2J2_HUMAN
INTEDE ID
DME0031
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1573
EC Number EC: 1.14.14.24
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.24
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
Function
This enzyme is involved in the metabolism of polyunsaturated fatty acids (PUFA) in the cardiovascular system. It catalyzes the epoxidation of double bonds of PUFA and converts arachidonic acid to four regioisomeric epoxyeicosatrienoic acids (EpETrE). In endothelial cells, it participates in eicosanoids metabolism by converting hydroperoxide species into hydroxy epoxy metabolites. In combination with 15- lipoxygenase , it metabolizes arachidonic acid and converts hydroperoxyicosatetraenoates (HpETEs) into hydroxy epoxy eicosatrienoates (HEETs). It can also catalyzes the monooxygenation of a various xenobiotics, such as danazol, amiodarone, terfenadine, astemizole, thioridazine, tamoxifen, cyclosporin A and nabumetone; catalyzes hydroxylation of the anthelmintics albendazole and fenbendazole; and catalyzes the sulfoxidation of fenbedazol.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Inflammatory mediator regulation of TRP channels (hsa04750 )
Linoleic acid metabolism (hsa00591 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Serotonergic synapse (hsa04726 )
Reactome Pathway
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 )
Xenobiotics (R-HSA-211981 )
Fatty acids (R-HSA-211935 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
8 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ergocalciferol DMHO0AR Hypoparathyroidism 5A50 Approved [1]
Levomilnacipran DMV26S8 Fibromyalgia MG30.01 Approved []
Riociguat DMXBLMP Chronic thromboembolic pulmonary hypertension Approved [2]
Rivaroxaban DMQMBZ1 Deep vein thrombosis BD71 Approved [3]
Vitamin D DMWQUC9 N. A. N. A. Approved [1]
Vorapaxar DMA16BR Myocardial infarction BA41-BA43 Approved [4]
Alfacalcidol DM1237M Hyperparathyroidism 5A51 Phase 4 [1]
Ebastine DMH21D9 N. A. N. A. Phase 4 [5]
⏷ Show the Full List of 8 Approved Drug(s)
4 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Carebastine DMUVMWZ Ocular allergy 4A81 Phase 3 [6]
Eperisone DM1SMAI Muscle spasm MB47.3 Phase 3 [7]
MANIDIPINE DMJPGUA N. A. N. A. Phase 3 [8]
H3B-6545 DMIFCY2 Breast cancer 2C60-2C65 Phase 1/2 [9]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Astemizole DM2HN6Q Allergic rhinitis CA08.0 Withdrawn from market [5]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Desmethylastemizole DM58XJN Discovery agent N.A. Investigative [10]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Ergocalciferol Hypoparathyroidism [5A50] Approved Km = 0.002 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.14E-01 2.37E-02 8.44E-02
Alopecia ED70 Skin from scalp 8.57E-03 2.79E-01 6.50E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.60E-06 2.85E-01 4.38E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.42E-01 3.67E-02 3.06E-01
Aortic stenosis BB70 Calcified aortic valve 9.52E-01 -4.46E-02 -6.97E-02
Apnea 7A40 Hyperplastic tonsil 3.34E-01 -1.67E-01 -1.05E+00
Arthropathy FA00-FA5Z Peripheral blood 4.85E-01 7.88E-02 3.86E-01
Asthma CA23 Nasal and bronchial airway 6.23E-02 -5.54E-02 -1.15E-01
Atopic dermatitis EA80 Skin 2.76E-14 -1.07E+00 -2.59E+00
Autism 6A02 Whole blood 3.29E-01 -4.05E-02 -1.92E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.10E-02 -7.56E-02 -7.92E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.24E-01 6.98E-02 4.39E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.42E-06 -2.35E-01 -5.19E-01
Batten disease 5C56.1 Whole blood 7.23E-01 -8.54E-02 -4.69E-01
Behcet's disease 4A62 Peripheral blood 7.92E-01 -3.85E-02 -1.68E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.67E-01 3.76E-02 1.03E-01
Bladder cancer 2C94 Bladder tissue 9.80E-03 -1.07E+00 -1.55E+00
Breast cancer 2C60-2C6Z Breast tissue 5.41E-03 1.47E-01 1.61E-01
Cardioembolic stroke 8B11.20 Whole blood 4.35E-01 -2.01E-01 -4.23E-01
Cervical cancer 2C77 Cervical tissue 1.59E-04 -1.10E+00 -1.45E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.42E-01 4.03E-02 2.08E-01
Chronic hepatitis C 1E51.1 Whole blood 6.01E-01 -9.03E-03 -4.16E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 9.86E-01 2.48E-02 5.42E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.11E-04 -2.56E-01 -7.31E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.09E-03 -1.27E+00 -1.50E+00
Colon cancer 2B90 Colon tissue 2.15E-54 -6.79E-01 -1.79E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.27E-01 -1.62E-01 -4.76E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.94E-01 1.07E-02 3.57E-02
Endometriosis GA10 Endometrium tissue 6.07E-04 -1.28E+00 -1.12E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.00E-01 -1.92E-02 -9.96E-02
Familial hypercholesterolemia 5C80.00 Whole blood 9.07E-02 -7.58E-02 -3.00E-01
Gastric cancer 2B72 Gastric tissue 3.81E-01 5.88E-01 5.91E-01
Glioblastopma 2A00.00 Nervous tissue 4.15E-30 -6.94E-01 -8.77E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.53E-04 -1.42E+00 -7.41E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.79E-05 -1.57E+00 -2.37E+00
Head and neck cancer 2D42 Head and neck tissue 4.65E-32 -2.31E+00 -1.96E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.77E-01 1.66E-01 3.08E-01
Huntington's disease 8A01.10 Whole blood 7.93E-01 7.10E-02 3.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.17E-01 4.81E-01 7.68E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.07E-03 3.79E-01 3.59E+00
Influenza 1E30 Whole blood 3.76E-02 4.22E-01 2.03E+00
Interstitial cystitis GC00.3 Bladder tissue 5.49E-06 -2.82E+00 -7.05E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.25E-02 -3.03E-01 -4.60E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.62E-01 -2.57E-02 -1.59E-01
Ischemic stroke 8B11 Peripheral blood 1.81E-01 8.39E-02 3.70E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.23E-01 -4.88E-03 -1.16E-02
Lateral sclerosis 8B60.4 Skin 7.89E-02 1.64E-01 1.44E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.05E-02 -1.91E-01 -3.31E-01
Liver cancer 2C12.0 Liver tissue 9.95E-21 -9.10E-01 -1.84E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.07E-03 -2.67E+00 -7.56E+00
Lung cancer 2C25 Lung tissue 1.40E-26 6.69E-01 1.18E+00
Lupus erythematosus 4A40 Whole blood 6.17E-01 1.18E-01 2.09E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.55E-02 -2.00E-01 -5.49E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.01E-01 -9.28E-02 -2.34E-01
Melanoma 2C30 Skin 5.28E-02 -2.35E-01 -2.63E-01
Multiple myeloma 2A83.1 Peripheral blood 7.02E-01 2.08E-02 8.32E-02
Multiple myeloma 2A83.1 Bone marrow 2.17E-03 3.70E-01 1.38E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.32E-01 -4.03E-02 -1.63E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.45E-01 8.05E-02 2.87E-01
Myelofibrosis 2A20.2 Whole blood 7.37E-03 -6.25E-02 -4.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.21E-01 1.87E-01 2.85E-01
Myopathy 8C70.6 Muscle tissue 6.46E-02 4.00E-01 5.64E-01
Neonatal sepsis KA60 Whole blood 4.91E-07 -1.48E-01 -6.59E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.86E-11 -2.20E+00 -6.35E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.26E-01 7.17E-02 2.72E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.57E-01 -3.57E-01 -7.97E-01
Olive pollen allergy CA08.00 Peripheral blood 1.74E-01 8.33E-02 5.10E-01
Oral cancer 2B6E Oral tissue 2.86E-07 -1.21E+00 -1.80E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.68E-01 -1.32E-01 -1.09E-01
Osteoporosis FB83.1 Bone marrow 2.17E-02 3.55E-01 2.25E+00
Ovarian cancer 2C73 Ovarian tissue 3.08E-06 9.59E-01 2.83E+00
Pancreatic cancer 2C10 Pancreas 7.10E-04 6.72E-01 9.48E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.13E-02 2.48E-01 6.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.35E-03 2.52E-01 1.35E+00
Pituitary cancer 2D12 Pituitary tissue 2.75E-02 -4.13E-01 -9.44E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.88E-03 -8.19E-01 -1.77E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.76E-02 -2.55E-01 -1.12E+00
Polycythemia vera 2A20.4 Whole blood 8.78E-01 1.90E-02 1.14E-01
Pompe disease 5C51.3 Biceps muscle 8.47E-05 9.45E-01 3.11E+00
Preterm birth KA21.4Z Myometrium 6.14E-01 0.00E+00 0.00E+00
Prostate cancer 2C82 Prostate 2.43E-03 9.40E-01 9.91E-01
Psoriasis EA90 Skin 9.69E-19 -8.33E-01 -1.47E+00
Rectal cancer 2B92 Rectal colon tissue 2.30E-12 -6.88E-01 -6.08E+00
Renal cancer 2C90-2C91 Kidney 1.81E-19 1.37E+00 4.29E+00
Retinoblastoma 2D02.2 Uvea 1.30E-06 -1.51E+00 -3.85E+00
Rheumatoid arthritis FA20 Synovial tissue 9.77E-02 -4.27E-01 -3.17E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.33E-01 -6.46E-02 -1.82E-01
Schizophrenia 6A20 Prefrontal cortex 5.31E-01 -5.76E-03 -7.30E-03
Schizophrenia 6A20 Superior temporal cortex 9.87E-01 1.15E-01 2.37E-01
Scleroderma 4A42.Z Whole blood 7.11E-02 1.59E-01 9.29E-01
Seizure 8A60-8A6Z Whole blood 2.74E-01 -1.11E-01 -3.15E-01
Sensitive skin EK0Z Skin 3.07E-01 4.04E-02 7.57E-01
Sepsis with septic shock 1G41 Whole blood 3.70E-01 3.53E-02 1.38E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.97E-01 3.69E-01 1.05E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.14E-02 8.72E-02 5.22E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.49E-01 4.36E-02 4.26E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.82E-01 -1.59E-01 -6.55E-01
Skin cancer 2C30-2C3Z Skin 3.43E-59 -1.20E+00 -2.18E+00
Thrombocythemia 3B63 Whole blood 5.53E-01 5.03E-02 3.18E-01
Thrombocytopenia 3B64 Whole blood 6.15E-02 -1.85E-01 -8.97E-01
Thyroid cancer 2D10 Thyroid 1.61E-13 2.49E-01 7.64E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.55E-04 6.86E-01 1.28E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.75E-01 4.97E-01 1.16E+00
Type 2 diabetes 5A11 Liver tissue 7.55E-01 -1.46E-02 -3.80E-02
Ureter cancer 2C92 Urothelium 6.84E-01 -5.00E-02 -2.27E-01
Uterine cancer 2C78 Endometrium tissue 3.34E-06 -3.34E-01 -3.24E-01
Vitiligo ED63.0 Skin 1.81E-01 -3.01E-01 -5.81E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cytochrome P450 2J2 DTT Info

References

1 Characterization of rat and human CYP2J enzymes as Vitamin D 25-hydroxylases. Steroids. 2006 Oct;71(10):849-56.
2 Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
3 Comparative efficacy and safety of the novel oral anticoagulants dabigatran, rivaroxaban and apixaban in preclinical and clinical development. Thromb Haemost. 2010 Mar;103(3):572-85.
4 Vorapaxar: the missing link in antiplatelet therapy! J Anaesthesiol Clin Pharmacol. 2017 Apr-Jun;33(2):269-270.
5 Identifying a selective substrate and inhibitor pair for the evaluation of CYP2J2 activity. Drug Metab Dispos. 2012 May;40(5):943-51.
6 Characterization of ebastine, hydroxyebastine, and carebastine metabolism by human liver microsomes and expressed cytochrome P450 enzymes: major roles for CYP2J2 and CYP3A. Drug Metab Dispos. 2006 Nov;34(11):1793-7.
7 Characterization of human cytochrome P450 enzymes involved in the biotransformation of eperisone. Xenobiotica. 2009 Jan;39(1):1-10.
8 Inhibitory effects of antihypertensive drugs on human cytochrome P450 2J2 activity: Potent inhibition by azelnidipine and manidipine. Chem Biol Interact. 2019 Jun 1;306:1-9.
9 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
10 Involvement of CYP2J2 on the intestinal first-pass metabolism of antihistamine drug, astemizole. Drug Metab Dispos. 2002 Nov;30(11):1240-5.