Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEUATVX)

DME Name Quinone reductase 2 (NQO2)
Synonyms NRH:quinone oxidoreductase 2; NRH dehydrogenase [quinone] 2; Ribosyldihydronicotinamide dehydrogenase [quinone]; NMOR2; NQO2; QR2
Gene Name NQO2
UniProt ID
NQO2_HUMAN
INTEDE ID
DME0567
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4835
EC Number EC: 1.10.5.1
Oxidoreductase
Diphenol donor oxidoreductase
Quinone oxidoreductase
EC: 1.10.5.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Function This enzyme serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways.
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nicotinamide riboside DMJBYSE Mitochondrial myopathy 8C73 Phase 1 [8]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.55E-27 -6.26E-01 -1.36E+00
Alopecia ED70 Skin from scalp 4.26E-05 3.40E-01 9.48E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.97E-01 -8.79E-03 -2.26E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 6.34E-01 1.27E-01 4.84E-01
Aortic stenosis BB70 Calcified aortic valve 9.18E-01 -2.52E-02 -5.90E-02
Apnea 7A40 Hyperplastic tonsil 9.48E-03 -8.06E-01 -2.20E+00
Arthropathy FA00-FA5Z Peripheral blood 4.75E-02 2.36E-01 4.24E-01
Asthma CA23 Nasal and bronchial airway 1.25E-06 2.55E-01 5.10E-01
Atopic dermatitis EA80 Skin 3.07E-06 3.84E-01 1.42E+00
Autism 6A02 Whole blood 2.25E-01 -1.76E-01 -4.41E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.94E-01 1.63E-01 4.24E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.40E-01 -6.99E-01 -1.32E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.76E-01 2.94E-02 1.18E-01
Batten disease 5C56.1 Whole blood 9.25E-02 3.28E-01 1.59E+00
Behcet's disease 4A62 Peripheral blood 3.24E-01 3.10E-02 1.37E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.34E-01 1.23E-01 4.11E-01
Bladder cancer 2C94 Bladder tissue 9.97E-01 -1.10E-01 -4.72E-01
Breast cancer 2C60-2C6Z Breast tissue 1.56E-10 -1.27E-01 -3.42E-01
Cardioembolic stroke 8B11.20 Whole blood 4.50E-08 1.03E+00 1.95E+00
Cervical cancer 2C77 Cervical tissue 2.01E-01 -1.10E-01 -4.00E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.40E-01 -5.60E-02 -7.33E-02
Chronic hepatitis C 1E51.1 Whole blood 6.54E-01 6.88E-02 1.74E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.75E-01 -1.10E-01 -4.41E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.18E-01 -3.08E-03 -1.48E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.10E-01 7.03E-02 2.83E-01
Colon cancer 2B90 Colon tissue 8.71E-39 5.43E-01 1.45E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.64E-01 7.27E-03 3.09E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.35E-01 9.60E-02 2.28E-01
Endometriosis GA10 Endometrium tissue 1.14E-01 2.21E-03 5.82E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.11E-01 3.63E-02 2.12E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.90E-01 9.71E-02 2.66E-01
Gastric cancer 2B72 Gastric tissue 9.67E-01 8.48E-03 4.54E-02
Glioblastopma 2A00.00 Nervous tissue 1.56E-88 -7.45E-01 -1.42E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.25E-01 -1.14E+00 -1.89E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.19E-02 5.05E-01 8.26E-01
Head and neck cancer 2D42 Head and neck tissue 9.82E-05 -1.90E-01 -7.68E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.95E-01 -1.80E-01 -4.50E-01
Huntington's disease 8A01.10 Whole blood 7.09E-01 9.54E-02 2.62E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.92E-02 -2.57E-01 -1.53E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.98E-05 4.91E-01 2.41E+00
Influenza 1E30 Whole blood 3.18E-02 -2.14E-01 -2.12E+00
Interstitial cystitis GC00.3 Bladder tissue 2.11E-02 3.87E-01 1.48E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.03E-03 3.23E-01 1.37E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.13E-01 6.33E-02 1.45E-01
Ischemic stroke 8B11 Peripheral blood 2.66E-01 1.33E-02 3.98E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.92E-01 -5.39E-02 -7.01E-02
Lateral sclerosis 8B60.4 Skin 3.20E-01 2.69E-01 6.09E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.06E-01 1.06E-01 1.76E-01
Liver cancer 2C12.0 Liver tissue 1.00E-05 -2.61E-01 -7.96E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.71E-01 -1.39E-01 -4.84E-01
Lung cancer 2C25 Lung tissue 4.62E-01 -4.55E-02 -1.63E-01
Lupus erythematosus 4A40 Whole blood 2.13E-08 4.62E-01 6.86E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.09E-01 1.14E-01 3.84E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.03E-01 -3.64E-02 -5.26E-02
Melanoma 2C30 Skin 1.52E-03 -5.80E-01 -8.09E-01
Multiple myeloma 2A83.1 Peripheral blood 6.89E-01 -5.64E-02 -1.46E-01
Multiple myeloma 2A83.1 Bone marrow 3.14E-04 4.06E-01 2.37E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.49E-01 7.60E-02 1.04E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.20E-04 3.33E-01 8.90E-01
Myelofibrosis 2A20.2 Whole blood 9.07E-01 -3.52E-02 -9.49E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.53E-01 1.66E-01 2.84E-01
Myopathy 8C70.6 Muscle tissue 4.12E-03 -2.97E-01 -1.80E+00
Neonatal sepsis KA60 Whole blood 8.18E-30 1.13E+00 2.35E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.41E-02 3.15E-01 9.17E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.18E-01 1.91E-03 6.33E-03
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.68E-01 1.18E-01 6.19E-01
Olive pollen allergy CA08.00 Peripheral blood 1.97E-01 1.80E-01 1.55E+00
Oral cancer 2B6E Oral tissue 4.43E-04 -2.28E-01 -5.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.67E-01 -7.24E-03 -1.16E-02
Osteoporosis FB83.1 Bone marrow 1.27E-01 -4.16E-01 -2.45E+00
Ovarian cancer 2C73 Ovarian tissue 8.08E-02 -1.99E-01 -5.72E-01
Pancreatic cancer 2C10 Pancreas 9.02E-02 -1.53E-01 -4.37E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.16E-01 1.13E-02 2.31E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.00E-04 4.79E-01 1.28E+00
Pituitary cancer 2D12 Pituitary tissue 6.55E-01 -5.04E-02 -1.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.02E-02 3.69E-01 1.75E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.39E-01 -5.32E-02 -1.36E-01
Polycythemia vera 2A20.4 Whole blood 4.13E-04 3.45E-01 8.30E-01
Pompe disease 5C51.3 Biceps muscle 1.81E-02 3.95E-01 1.09E+00
Preterm birth KA21.4Z Myometrium 9.36E-02 -1.92E-01 -1.16E+00
Prostate cancer 2C82 Prostate 3.44E-02 3.44E-01 5.58E-01
Psoriasis EA90 Skin 5.77E-10 1.28E-01 5.59E-01
Rectal cancer 2B92 Rectal colon tissue 7.85E-01 -4.26E-02 -1.41E-01
Renal cancer 2C90-2C91 Kidney 4.80E-02 -9.62E-01 -1.18E+00
Retinoblastoma 2D02.2 Uvea 2.57E-01 4.14E-01 8.05E-01
Rheumatoid arthritis FA20 Synovial tissue 1.20E-01 4.72E-01 1.03E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.32E-01 -5.37E-02 -3.07E-01
Schizophrenia 6A20 Prefrontal cortex 9.28E-01 -3.53E-02 -8.73E-02
Schizophrenia 6A20 Superior temporal cortex 5.95E-01 -3.73E-02 -1.56E-01
Scleroderma 4A42.Z Whole blood 1.49E-02 3.28E-01 9.69E-01
Seizure 8A60-8A6Z Whole blood 9.57E-01 3.22E-01 6.11E-01
Sensitive skin EK0Z Skin 7.43E-01 -3.04E-02 -1.55E-01
Sepsis with septic shock 1G41 Whole blood 4.25E-106 1.46E+00 3.22E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.74E-01 1.12E-01 2.12E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.45E-01 1.58E-01 5.66E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.28E-01 -2.78E-02 -5.15E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.62E-02 -2.21E-01 -1.27E+00
Skin cancer 2C30-2C3Z Skin 2.82E-04 -1.05E-01 -2.44E-01
Thrombocythemia 3B63 Whole blood 5.70E-01 -1.07E-02 -2.78E-02
Thrombocytopenia 3B64 Whole blood 4.40E-01 1.21E-01 1.40E-01
Thyroid cancer 2D10 Thyroid 1.38E-01 -6.17E-02 -2.59E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.38E-03 -6.06E-01 -1.45E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.06E-02 -6.11E-01 -1.86E+00
Type 2 diabetes 5A11 Liver tissue 5.94E-01 -9.08E-02 -4.19E-01
Ureter cancer 2C92 Urothelium 4.00E-01 1.86E-02 1.07E-01
Uterine cancer 2C78 Endometrium tissue 9.08E-02 -1.09E-01 -3.15E-01
Vitiligo ED63.0 Skin 1.43E-01 7.80E-02 3.56E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Quinone reductase 2 (NQO2) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Melatonin DMKWFBT Depression 6A70-6A7Z Approved [1]
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
NSC-645809 DMPJQZG Breast cancer 2C60-2C65 Phase 2 [2]
Prolarix DMZIQ8G Solid tumour/cancer 2A00-2F9Z Phase 2 [3]
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CB1954 DMVP4YK Solid tumour/cancer 2A00-2F9Z Discontinued in Phase 2 [4]
65 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,4-Dimethylquinolin-2(1H)-one DMRT13B Discovery agent N.A. Investigative [5]
10-Propargyl-5,8-Dideazafolic Acid DMR3A5N N. A. N. A. Investigative [4]
2-iodo-melatonin DMSEIUP Discovery agent N.A. Investigative [5]
3,4,5-Trimethoxy-4'-amino-trans-stilbene DMDBOJ5 Discovery agent N.A. Investigative [6]
3,5-Dimethoxy-4'-amino-trans-stilbene DMC3917 Discovery agent N.A. Investigative [6]
5,6,8-Trimethoxy-1,4-dimethylquinolin-2(1H)-one DMNHT7Q Discovery agent N.A. Investigative [5]
5,6,8-Trimethoxy-4-methylquinolin-2(1H)-one DM97XZ1 Discovery agent N.A. Investigative [5]
5,8-dimethoxy-1,4-dimethylquinolin-2(1H)-one DMJ1IRO Discovery agent N.A. Investigative [1]
5,8-Dimethoxy-4-methylquinolin-2(1H)-one DMEMBKW Discovery agent N.A. Investigative [5]
6,7,8-Trimethoxy-1,4-dimethylquinolin-2(1H)-one DMAMD87 Discovery agent N.A. Investigative [5]
6,7,8-Trimethoxy-4-methylquinolin-2(1H)-one DMJX9NQ Discovery agent N.A. Investigative [5]
6,8-Dimethoxy-1,4-dimethylquinolin-2(1H)-one DMAFP18 Discovery agent N.A. Investigative [5]
6,8-Dimethoxy-4-methylquinolin-2(1H)-one DMYKSTZ Discovery agent N.A. Investigative [5]
6-Methyl-[1,3]dioxolo[4,5-h]quinolin-8(9H)-one DMOIC64 Discovery agent N.A. Investigative [5]
7,8-Dimethoxy-1,4-dimethylquinolin-2(1H)-one DMPF6MD Discovery agent N.A. Investigative [5]
8-Methoxy-1,4-dimethylquinolin-2(1H)-one DM0Y52J Discovery agent N.A. Investigative [5]
decynium 22 DMWCTZ7 Discovery agent N.A. Investigative [7]
Flavin-Adenine Dinucleotide DM5S4GK Discovery agent N.A. Investigative [4]
NSC-106080 DMR6P9S Discovery agent N.A. Investigative [7]
NSC-115890 DMPLUHT Discovery agent N.A. Investigative [7]
NSC-180969 DMZFHL0 Discovery agent N.A. Investigative [7]
NSC-204996 DMAQGIW Discovery agent N.A. Investigative [7]
NSC-238146 DMWXNOI Discovery agent N.A. Investigative [7]
NSC-300853 DM6IF8N Discovery agent N.A. Investigative [7]
NSC-306843 DMZYJU0 Discovery agent N.A. Investigative [7]
NSC-356819 DMXT1EK Discovery agent N.A. Investigative [7]
NSC-356820 DM9CM5V Discovery agent N.A. Investigative [7]
NSC-359466 DMHUG1W Discovery agent N.A. Investigative [7]
NSC-381864 DMLGWHM Discovery agent N.A. Investigative [7]
NSC-637991 DMY7EAF Discovery agent N.A. Investigative [2]
NSC-637992 DM0U7CK Discovery agent N.A. Investigative [2]
NSC-637993 DM2HC8L Discovery agent N.A. Investigative [2]
NSC-637994 DMKA8YT Discovery agent N.A. Investigative [2]
NSC-640353 DMZCYM1 Discovery agent N.A. Investigative [7]
NSC-640556 DM3DW6A Discovery agent N.A. Investigative [7]
NSC-640558 DMPFC5U Discovery agent N.A. Investigative [7]
NSC-640559 DMMT73G Discovery agent N.A. Investigative [7]
NSC-640566 DMSJ06G Discovery agent N.A. Investigative [7]
NSC-640583 DMC4Y0R Discovery agent N.A. Investigative [7]
NSC-640584 DMY2API Discovery agent N.A. Investigative [7]
NSC-645808 DMMBAR3 Discovery agent N.A. Investigative [2]
NSC-645811 DMCNIT2 Discovery agent N.A. Investigative [2]
NSC-645812 DM1MPJ9 Discovery agent N.A. Investigative [2]
NSC-645831 DMSO215 Discovery agent N.A. Investigative [2]
NSC-645833 DM1AD8T Discovery agent N.A. Investigative [2]
NSC-645834 DMY5JFB Discovery agent N.A. Investigative [2]
NSC-645835 DMKDVP7 Discovery agent N.A. Investigative [2]
NSC-645836 DMQ13SI Discovery agent N.A. Investigative [2]
NSC-649091 DM6F3HV Discovery agent N.A. Investigative [7]
NSC-660838 DMXDNQ6 Discovery agent N.A. Investigative [2]
NSC-660839 DM8LOCA Discovery agent N.A. Investigative [2]
NSC-660840 DMB5PLD Discovery agent N.A. Investigative [2]
NSC-660841 DMXHPV0 Discovery agent N.A. Investigative [2]
NSC-665126 DMNQXE0 Discovery agent N.A. Investigative [7]
NSC-669977 DMVFZKQ Discovery agent N.A. Investigative [7]
NSC-676468 DMY4MPG Discovery agent N.A. Investigative [7]
NSC-677939 DM35V46 Discovery agent N.A. Investigative [7]
NSC-693571 DMKMTJ9 Discovery agent N.A. Investigative [7]
NSC-720622 DMCP1I6 Discovery agent N.A. Investigative [7]
NSC-77833 DM82XAU Discovery agent N.A. Investigative [7]
NSC-78017 DM8R12J Discovery agent N.A. Investigative [7]
NSC-78021 DM7L3DE Discovery agent N.A. Investigative [7]
NSC-86715 DMA53YD Discovery agent N.A. Investigative [7]
NSC-99495 DM96X2U Discovery agent N.A. Investigative [7]
NSC-99528 DMXZAIG Discovery agent N.A. Investigative [7]
⏷ Show the Full List of 65 Investigative Drug(s)

References

1 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
2 Imidazoacridin-6-ones as novel inhibitors of the quinone oxidoreductase NQO2. Bioorg Med Chem Lett. 2010 May 1;20(9):2832-6.
3 CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008.
4 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
5 Synthesis of casimiroin and optimization of its quinone reductase 2 and aromatase inhibitory activities. J Med Chem. 2009 Apr 9;52(7):1873-84.
6 Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66.
7 In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6.
8 Insights into the redox cycle of human quinone reductase 2. Free Radic Res. 2011 Oct;45(10):1184-95.