Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEX2KIA)

DME Name Steroid 17-alpha-monooxygenase (CYP17A1)
Synonyms Steroid 17-alpha-hydroxylase/17,20 lyase; Cytochrome P450 17A1; 17-alpha-hydroxyprogesterone aldolase; Cytochrome P450-C17; Cytochrome P450c17; CYP17; CYP17A1; CYPXVII; S17AH
Gene Name CYP17A1
UniProt ID
CP17A_HUMAN
INTEDE ID
DME0024
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1586
EC Number EC: 1.14.99.9
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.99.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS
LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN
DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP
KVVFLIDSFKVKIKVRQAWREAQAEGST
Function
This enzyme is involved in corticoid and androgen biosynthesis. It catalyzes 17-alpha hydroxylation of C21 steroids, which is common for both pathways. A second oxidative step, required only for androgen synthesis, involves an acyl-carbon cleavage. The 17-alpha hydroxy intermediates, as part of adrenal glucocorticoids biosynthesis pathway, are precursors of cortisol. Hydroxylates steroid hormones, pregnenolone and progesterone to form 17-alpha hydroxy metabolites, followed by the cleavage of the C17-C20 bond to form C19 steroids, dehydroepiandrosterone (DHEA) and androstenedione. It has 16-alpha hydroxylase activity. It catalyzes 16-alpha hydroxylation of 17-alpha hydroxy pregnenolone, followed by the cleavage of the C17-C20 bond to form 16-alpha-hydroxy DHEA and also 16-alpha hydroxylates androgens, relevant for estriol synthesis.
KEGG Pathway
Cortisol synthesis and secretion (hsa04927 )
Cushing syndrome (hsa04934 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Prolactin signaling pathway (hsa04917 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Defective CYP17A1 causes Adrenal hyperplasia 5 (AH5) (R-HSA-5579028 )
Glucocorticoid biosynthesis (R-HSA-194002 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aminophenazone DMY2AH1 N. A. N. A. Phase 4 [27]
Dihydrotestosterone DM3S8XC Prostate hyperplasia GA90 Phase 4 [28]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dexniguldipine DMLZIT2 Solid tumour/cancer 2A00-2F9Z Discontinued in Phase 2 [29]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
SODIUM PHOSPHATE, DIBASIC, ANHYDROUS DM1G4S9 Discovery agent N.A. Investigative [30]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.03E-02 5.07E-02 3.70E-01
Alopecia ED70 Skin from scalp 1.39E-04 1.64E-01 7.81E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.92E-01 6.56E-03 4.68E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.81E-01 -1.05E-02 -1.16E-01
Aortic stenosis BB70 Calcified aortic valve 5.35E-01 8.56E-02 2.37E-01
Apnea 7A40 Hyperplastic tonsil 7.85E-02 -1.82E-01 -1.19E+00
Arthropathy FA00-FA5Z Peripheral blood 5.72E-01 2.67E-02 1.72E-01
Asthma CA23 Nasal and bronchial airway 7.51E-02 -7.69E-02 -2.01E-01
Atopic dermatitis EA80 Skin 1.32E-01 -6.74E-02 -8.12E-01
Autism 6A02 Whole blood 2.97E-01 -4.94E-02 -2.93E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.13E-02 -1.30E-01 -1.45E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.15E-01 4.60E-02 5.27E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.29E-01 4.11E-02 2.17E-01
Batten disease 5C56.1 Whole blood 7.22E-02 6.92E-02 5.51E-01
Behcet's disease 4A62 Peripheral blood 5.29E-01 9.97E-02 5.74E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.61E-01 -3.66E-02 -3.31E-01
Bladder cancer 2C94 Bladder tissue 2.48E-04 3.44E-01 1.93E+00
Breast cancer 2C60-2C6Z Breast tissue 2.29E-05 -8.31E-02 -3.09E-01
Cardioembolic stroke 8B11.20 Whole blood 9.87E-02 1.62E-01 4.83E-01
Cervical cancer 2C77 Cervical tissue 3.32E-01 -8.99E-03 -5.15E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.70E-01 -5.12E-02 -2.64E-01
Chronic hepatitis C 1E51.1 Whole blood 9.22E-01 9.87E-02 5.57E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.81E-01 3.59E-04 2.68E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.10E-02 1.07E-01 6.73E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.16E-01 -2.18E-02 -2.95E-01
Colon cancer 2B90 Colon tissue 2.87E-04 -3.96E-02 -1.97E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.40E-01 -3.00E-01 -1.77E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.86E-02 -1.20E-01 -7.85E-01
Endometriosis GA10 Endometrium tissue 6.43E-02 6.11E-02 2.79E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.51E-01 4.69E-02 2.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.96E-02 -1.11E-01 -7.01E-01
Gastric cancer 2B72 Gastric tissue 9.61E-01 4.25E-02 1.24E-01
Glioblastopma 2A00.00 Nervous tissue 3.25E-21 -1.29E-01 -6.19E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.69E-01 7.86E-02 2.74E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.71E-04 -1.27E+00 -2.00E+00
Head and neck cancer 2D42 Head and neck tissue 1.26E-01 -4.31E-02 -2.61E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.98E-02 -8.02E-02 -7.46E-01
Huntington's disease 8A01.10 Whole blood 2.90E-01 8.80E-02 5.81E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.00E-01 -1.76E-02 -8.18E-02
Immunodeficiency 4A00-4A20 Peripheral blood 6.10E-01 3.60E-02 4.29E-01
Influenza 1E30 Whole blood 3.98E-03 4.02E-01 3.62E+00
Interstitial cystitis GC00.3 Bladder tissue 8.29E-01 1.50E-02 8.25E-02
Intracranial aneurysm 8B01.0 Intracranial artery 2.68E-01 7.42E-02 4.55E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.75E-01 7.09E-02 3.08E-01
Ischemic stroke 8B11 Peripheral blood 6.33E-02 8.10E-02 8.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.49E-03 1.73E-01 5.18E-01
Lateral sclerosis 8B60.4 Skin 1.00E-01 5.90E-02 1.40E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.17E-02 7.23E-02 6.09E-01
Liver cancer 2C12.0 Liver tissue 2.96E-04 -1.28E-01 -4.75E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.37E-03 -1.80E-01 -1.34E+00
Lung cancer 2C25 Lung tissue 6.79E-09 -8.61E-02 -5.17E-01
Lupus erythematosus 4A40 Whole blood 8.00E-01 1.17E-02 5.24E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.70E-01 1.64E-02 1.48E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.13E-01 -5.93E-02 -1.76E-01
Melanoma 2C30 Skin 1.17E-01 -9.92E-02 -2.23E-01
Multiple myeloma 2A83.1 Peripheral blood 5.58E-01 -8.23E-02 -4.60E-01
Multiple myeloma 2A83.1 Bone marrow 2.93E-01 -7.68E-02 -3.97E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.72E-01 -5.21E-03 -3.05E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.47E-01 2.37E-02 1.23E-01
Myelofibrosis 2A20.2 Whole blood 9.46E-01 3.11E-03 2.06E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.06E-01 8.82E-02 2.49E-01
Myopathy 8C70.6 Muscle tissue 1.54E-02 -1.93E-01 -1.69E+00
Neonatal sepsis KA60 Whole blood 8.23E-01 -6.27E-04 -3.00E-03
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.16E-04 -4.12E-01 -2.07E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.86E-01 -6.90E-02 -4.16E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.92E-01 6.33E-02 9.27E-01
Olive pollen allergy CA08.00 Peripheral blood 8.33E-01 2.32E-02 1.35E-01
Oral cancer 2B6E Oral tissue 1.02E-06 -2.79E-01 -1.30E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.58E-01 -9.59E-02 -2.94E-01
Osteoporosis FB83.1 Bone marrow 7.17E-01 -5.90E-02 -5.86E-01
Ovarian cancer 2C73 Ovarian tissue 8.13E-02 -1.93E-01 -1.10E-01
Pancreatic cancer 2C10 Pancreas 1.41E-01 -1.02E-01 -4.58E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.76E-01 1.56E-03 8.86E-03
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.51E-01 -8.00E-02 -7.16E-01
Pituitary cancer 2D12 Pituitary tissue 8.11E-01 5.26E-02 1.05E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.20E-01 8.67E-02 4.28E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.97E-01 -6.18E-02 -5.14E-01
Polycythemia vera 2A20.4 Whole blood 3.05E-01 5.98E-02 4.27E-01
Pompe disease 5C51.3 Biceps muscle 4.28E-05 -9.69E-01 -2.34E+00
Preterm birth KA21.4Z Myometrium 6.29E-01 -6.54E-02 -3.98E-01
Prostate cancer 2C82 Prostate 6.87E-01 7.13E-02 2.06E-01
Psoriasis EA90 Skin 4.62E-02 5.45E-02 2.76E-01
Rectal cancer 2B92 Rectal colon tissue 1.97E-01 -1.41E-01 -9.39E-01
Renal cancer 2C90-2C91 Kidney 1.90E-03 -1.34E+00 -1.48E+00
Retinoblastoma 2D02.2 Uvea 1.32E-08 -4.61E-01 -3.77E+00
Rheumatoid arthritis FA20 Synovial tissue 1.15E-01 -7.78E-02 -2.06E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.32E-01 -2.52E-02 -2.28E-01
Schizophrenia 6A20 Prefrontal cortex 8.90E-02 4.30E-02 2.27E-01
Schizophrenia 6A20 Superior temporal cortex 4.15E-01 -5.15E-02 -6.86E-01
Scleroderma 4A42.Z Whole blood 1.24E-01 8.80E-02 5.89E-01
Seizure 8A60-8A6Z Whole blood 5.32E-01 2.44E-02 1.11E-01
Sensitive skin EK0Z Skin 1.96E-01 6.51E-02 5.39E-01
Sepsis with septic shock 1G41 Whole blood 3.00E-03 1.13E-01 5.01E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.07E-01 -2.37E-02 -1.62E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.32E-02 1.80E-01 8.73E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.42E-01 1.54E-01 4.07E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.12E-02 -2.43E-01 -4.30E+00
Skin cancer 2C30-2C3Z Skin 1.89E-08 -1.51E-01 -5.89E-01
Thrombocythemia 3B63 Whole blood 4.64E-01 3.41E-02 2.11E-01
Thrombocytopenia 3B64 Whole blood 4.92E-01 1.32E-01 5.22E-01
Thyroid cancer 2D10 Thyroid 1.16E-20 -3.84E-01 -1.53E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.51E-05 -2.92E-01 -2.29E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.12E-01 1.33E-01 1.08E+00
Type 2 diabetes 5A11 Liver tissue 9.19E-01 -2.70E-02 -1.81E-01
Ureter cancer 2C92 Urothelium 9.27E-01 -9.12E-02 -5.27E-01
Uterine cancer 2C78 Endometrium tissue 4.94E-03 7.13E-02 3.38E-01
Vitiligo ED63.0 Skin 9.40E-01 2.25E-02 1.12E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Steroid 17-alpha-monooxygenase (S17AH) DTT Info
DME DTT Type Successful
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ABIRATERONE DM8V75C Prostate cancer 2C82.0 Approved [1]
Abiraterone acetate DMANBZI Prostate cancer 2C82.0 Approved [2]
5 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
TAK-700 DM2H8FZ Prostate cancer 2C82.0 Phase 3 [3]
TAVT-45 DMHBRGT Prostate cancer 2C82.0 Phase 3 [4]
Seviteronel DM9IMEZ Breast cancer 2C60-2C65 Phase 2 [5]
CFG920 DM2BXDU Prostate cancer 2C82.0 Phase 1/2 [6]
DST-2970 DM69ZBU Prostate cancer 2C82.0 Phase 1 [7]
89 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1-((9H-Fluoren-2-yl)ethyl)-1H-imidazole DMGRV8U Discovery agent N.A. Investigative [8]
1-((9H-Fluoren-2-yl)methyl)-1H-imidazole DMPBJ9L Discovery agent N.A. Investigative [8]
1-(1-(4'-Ethylbiphenyl-4-yl)propyl)-1H-imidazole DMOQPKT Discovery agent N.A. Investigative [8]
1-(1-(4-thiophen-3-yl-phenyl)propyl)-1Himidazole DMQF2N5 Discovery agent N.A. Investigative [9]
1-(1-(4-thiophen-3-ylphenyl)ethyl)-1H-imidazole DMEIH5N Discovery agent N.A. Investigative [9]
1-(1-(Biphenyl-4-yl)allyl)-1H-imidazole DMLJ7WA Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-2-methyl-propyl)-1H-imidazole DMPEIQT Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-2-phenyl-ethyl)-1H-imidazole DMCTF8X Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-3-methyl-butyl)-1H-imidazole DMWME7I Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-butyl)-1H-imidazole DM4XILF Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-ethyl)-1H-imidazole DMW85CH Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-pentyl)-1H-imidazole DM3AD7E Discovery agent N.A. Investigative [8]
1-(1-Biphenyl-4-yl-propyl)-1H-imidazole DMGVE3F Discovery agent N.A. Investigative [8]
1-(3,4-dichlorobenzyl)-1H-imidazole DMX6PKO Discovery agent N.A. Investigative [10]
1-(3,4-difluorobenzyl)-1H-imidazole DMRXD2P Discovery agent N.A. Investigative [10]
1-(3,5-bis(trifluoromethyl)benzyl)-1H-imidazole DM5WOK8 Discovery agent N.A. Investigative [10]
1-(3,5-dibromobenzyl)-1H-imidazole DMNRCM0 Discovery agent N.A. Investigative [10]
1-(3,5-dichlorobenzyl)-1H-imidazole DMLSWHP Discovery agent N.A. Investigative [10]
1-(3,5-difluorobenzyl)-1H-imidazole DMEAI6V Discovery agent N.A. Investigative [10]
1-(3-(4-chlorophenyl)propyl)-1H-imidazole DMIFARP Discovery agent N.A. Investigative [11]
1-(3-(4-fluorophenyl)propyl)-1H-imidazole DMWKXZ2 Discovery agent N.A. Investigative [11]
1-(3-phenylpropyl)-1H-imidazole DMPAWFJ Discovery agent N.A. Investigative [11]
1-(4-Bromobenzyl)-1H-imidazole DM2C7U0 Discovery agent N.A. Investigative [11]
1-(4-bromophenethyl)-1H-imidazole DME8B15 Discovery agent N.A. Investigative [11]
1-(4-chlorobenzyl)-1H-imidazole DMBR9TQ Discovery agent N.A. Investigative [11]
1-(4-chlorophenethyl)-1H-imidazole DM9MDZG Discovery agent N.A. Investigative [11]
1-(4-fluorobenzyl)-1H-imidazole DMBJCGA Discovery agent N.A. Investigative [11]
1-(4-iodobenzyl)-1H-imidazole DMM17I0 Discovery agent N.A. Investigative [12]
1-(4-methyl-benzyl)-1H-imidazole DM48ISZ Discovery agent N.A. Investigative [10]
1-(4-nitrobenzyl)-1H-imidazole DMKT2MB Discovery agent N.A. Investigative [10]
1-(Bis-biphenyl-4-yl-methyl)-1H-imidazole DMF3D5R Discovery agent N.A. Investigative [8]
1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole DMUOSJG Discovery agent N.A. Investigative [13]
1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one DMN7KHS Discovery agent N.A. Investigative [14]
1-Imidazol-1-ylmethylxanthen-9-one DMIDX7P Discovery agent N.A. Investigative [15]
2,3,4,5-Tetrafluoro-6-pentafluorophenylazo-phenol DMGQE4B Discovery agent N.A. Investigative [16]
2,3,5,6-Tetrafluoro-4-pentafluorophenylazo-phenol DMRVYKQ Discovery agent N.A. Investigative [16]
2-(1-Imidazol-1-yl-ethyl)-9H-carbazole DM4MIXK Discovery agent N.A. Investigative [8]
3-(1-Chloro-7-methoxy-naphthalen-2-yl)-pyridine DMLH7YI Discovery agent N.A. Investigative [17]
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine DMR7M82 Discovery agent N.A. Investigative [18]
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine DMU5HMC Discovery agent N.A. Investigative [18]
3-(6-Ethoxy-naphthalen-2-yl)-pyridine DMUQ0WI Discovery agent N.A. Investigative [17]
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine DMAJHXO Discovery agent N.A. Investigative [18]
3-(6-methoxynaphthalen-2-yl)pyridine DMYRJAB Discovery agent N.A. Investigative [19]
3-fluoro-4'-(1-(pyridin-4-yl)propyl)biphenyl-4-ol DM4PLSU Discovery agent N.A. Investigative [20]
3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol DMJ3WNP Discovery agent N.A. Investigative [21]
3-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine DMHISM2 Discovery agent N.A. Investigative [21]
3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMPS340 Discovery agent N.A. Investigative [22]
4'-(1-(pyridin-4-yl)propyl)biphenyl-3-ol DMEW1CP Discovery agent N.A. Investigative [20]
4'-(2-methyl-1-(pyridin-4-yl)propyl)biphenyl-3-ol DM6DSNI Discovery agent N.A. Investigative [20]
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diamine DMZ0H5X Discovery agent N.A. Investigative [21]
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol DM6Z5EK Discovery agent N.A. Investigative [21]
4'-(Pyridin-4-ylmethyl)biphenyl-3-amine DMR8O1B Discovery agent N.A. Investigative [21]
4'-(Pyridin-4-ylmethyl)biphenyl-4-amine DM8HXYS Discovery agent N.A. Investigative [21]
4'-(Pyridin-4-ylmethyl)biphenyl-4-carboxamide DMYXMT6 Discovery agent N.A. Investigative [21]
4-((1H-imidazol-1-yl)methyl)benzonitrile DMFUBRC Discovery agent N.A. Investigative [10]
4-((1H-imidazol-1-yl)methyl)phenol DMYDGH4 Discovery agent N.A. Investigative [12]
4-((3',4'-Difluorobiphenyl-4-yl)methyl)pyridine DMHN5OL Discovery agent N.A. Investigative [21]
4-(4'-Fluoro-biphenyl-4-ylmethyl)pyridine DM52NMU Discovery agent N.A. Investigative [21]
4-(4-(thiophen-2-yl)benzyl)pyridine DMVXJU6 Discovery agent N.A. Investigative [21]
4-(4-(thiophen-3-yl)benzyl)pyridine DM7I21V Discovery agent N.A. Investigative [21]
4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one DMMVASI Discovery agent N.A. Investigative [14]
4-Indan-(1Z)-ylidenemethyl-pyridine DM25DR7 Discovery agent N.A. Investigative [22]
4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine DM04MK7 Discovery agent N.A. Investigative [21]
4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine DMIEMWA Discovery agent N.A. Investigative [21]
4-[1-(4'-Methoxybiphenyl-4-yl)propyl]pyridine DMCEABJ Discovery agent N.A. Investigative [21]
4-[4-(6-methoxynaphthalen-2-yl)benzyl]pyridine DM62351 Discovery agent N.A. Investigative [21]
4-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine DMI7YAQ Discovery agent N.A. Investigative [22]
4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine DMQKHXN Discovery agent N.A. Investigative [22]
4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine DMZL8KN Discovery agent N.A. Investigative [22]
4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DM1Z3DG Discovery agent N.A. Investigative [22]
4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMY08FE Discovery agent N.A. Investigative [22]
4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMHDZUO Discovery agent N.A. Investigative [22]
5-[4-(Pyridin-4-ylmethyl)phenyl]-1H-indole DMW8RLN Discovery agent N.A. Investigative [21]
5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine DM2RIHT Discovery agent N.A. Investigative [22]
6-(3-(pyridin-4-yl)phenyl)naphthalen-2-ol DMA8TWC Discovery agent N.A. Investigative [23]
6-(pyridin-3-yl)-2-naphthonitrile DMC3SJI Discovery agent N.A. Investigative [19]
6-Pyridin-3-yl-3,4-dihydroquinoline-2(1H)-thione DMHAS2B Discovery agent N.A. Investigative [19]
6-Pyridin-3-yl-naphthalen-2-ol DMGWNDB Discovery agent N.A. Investigative [17]
6-[4-(Pyridin-4-ylmethyl)phenyl]naphthalen-2-ol DM40LQ9 Discovery agent N.A. Investigative [21]
7-(1-(1H-imidazol-1-yl)ethyl)-9H-fluoren-2-ol DMRPFNU Discovery agent N.A. Investigative [8]
ANG-3407 DMVI93X Prostate cancer 2C82.0 Investigative [24]
ISOCONAZOLE DMMF1HX Discovery agent N.A. Investigative [25]
N-(4'-Isonicotinoylbiphenyl-3-yl)acetamide DM2N3TG Discovery agent N.A. Investigative [21]
N-3-(4-bromophenyl)propyl imidazole DMFRD09 Discovery agent N.A. Investigative [11]
Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3,4-diol DMTN7IU Discovery agent N.A. Investigative [26]
Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3,5-diol DMQYRAB Discovery agent N.A. Investigative [26]
Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3-ol DMH2CX5 Discovery agent N.A. Investigative [26]
Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-4-ol DMUQ6FW Discovery agent N.A. Investigative [26]
VN/107-1 DMJRI6A Prostate cancer 2C82.0 Investigative [24]
⏷ Show the Full List of 89 Investigative Drug(s)

References

1 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
2 CYP17A1 inhibitors in castration-resistant prostate cancer.Steroids.2015 Mar;95:80-7.
3 Orteronel (TAK-700), a novel non-steroidal 17,20-lyase inhibitor: effects on steroid synthesis in human and monkey adrenal cells and serum steroid levels in cynomolgus monkeys. J Steroid Biochem Mol Biol. 2012 Apr;129(3-5):115-28.
4 Clinical pipeline report, company report or official report of Tavanta Therapeutics
5 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
6 Recent progress in pharmaceutical therapies for castration-resistant prostate cancer. Int J Mol Sci. 2013 Jul 4;14(7):13958-78.
7 Clinical pipeline report, company report or official report of DisperSol Technologies.
8 Synthesis, biological evaluation, and molecular modeling studies of methylene imidazole substituted biaryls as inhibitors of human 17alpha-hydroxyl... Bioorg Med Chem. 2008 Aug 15;16(16):7715-27.
9 Synthesis, biological evaluation and molecular modelling studies of methyleneimidazole substituted biaryls as inhibitors of human 17alpha-hydroxyla... Bioorg Med Chem. 2008 Feb 15;16(4):1992-2010.
10 Synthesis and biochemical evaluation of a range of potent benzyl imidazole-based compounds as potential inhibitors of the enzyme complex 17alpha-hy... Bioorg Med Chem Lett. 2006 Aug 1;16(15):4011-5.
11 Synthesis, biochemical evaluation and rationalisation of the inhibitory activity of a range of 4-substituted phenyl alkyl imidazole-based inhibitor... Bioorg Med Chem Lett. 2006 Sep 15;16(18):4752-6.
12 Synthesis and biochemical evaluation of a range of (4-substituted phenyl)sulfonate derivatives of 4-hydroxybenzyl imidazole-based compounds as pote... Bioorg Med Chem Lett. 2010 Sep 1;20(17):5345-8.
13 New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.
14 A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80.
15 Novel highly potent and selective nonsteroidal aromatase inhibitors: synthesis, biological evaluation and structure-activity relationships investigation. J Med Chem. 2010 Jul 22;53(14):5347-51.
16 Hydroxyperfluoroazobenzenes: novel inhibitors of enzymes of androgen biosynthesis. J Med Chem. 1990 Sep;33(9):2452-5.
17 Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart fa... J Med Chem. 2005 Oct 20;48(21):6632-42.
18 Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B... J Med Chem. 2006 Apr 6;49(7):2222-31.
19 In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87.
20 Isopropylidene substitution increases activity and selectivity of biphenylmethylene 4-pyridine type CYP17 inhibitors. J Med Chem. 2010 Jul 8;53(13):5049-53.
21 Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prosta... J Med Chem. 2010 Aug 12;53(15):5749-58.
22 Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitor... J Med Chem. 2005 Mar 10;48(5):1563-75.
23 Synthesis, biological evaluation and molecular modelling studies of novel ACD- and ABD-ring steroidomimetics as inhibitors of CYP17. Bioorg Med Chem Lett. 2008 Jan 1;18(1):267-73.
24 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1361).
25 Three dimensional pharmacophore modeling of human CYP17 inhibitors. Potential agents for prostate cancer therapy. J Med Chem. 2003 Jun 5;46(12):2345-51.
26 Novel CYP17 inhibitors: synthesis, biological evaluation, structure-activity relationships and modelling of methoxy- and hydroxy-substituted methyl... Eur J Med Chem. 2009 Jul;44(7):2765-75.
27 Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93.
28 Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta. Cancer Epidemiol Biomarkers Prev. 2005 Aug;14(8):2035-9.
29 In vitro metabolism of dexamethasone (DEX) in human liver and kidney: the involvement of CYP3A4 and CYP17 (17,20 LYASE) and molecular modelling studies. Biochem Pharmacol. 1997 Sep 1;54(5):605-11.
30 Transcriptional complexes at the CYP17 CRS. Endocr Res. 2002 Nov;28(4):551-8.