Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0B3H72)

DOT Name Nuclear apoptosis-inducing factor 1 (NAIF1)
Gene Name NAIF1
Related Disease
Gastric cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Stomach cancer ( )
Bone osteosarcoma ( )
Carcinoma ( )
Osteosarcoma ( )
UniProt ID
NAIF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13873
Sequence
MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVAT
CRRELPEVKKKWSDLKTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAV
APVLLTPMQQRICNLLGEATIISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTL
EEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVKPQALKSRIALNSAKLIQEQRVTNLHV
KEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL
QSNTANPAPASDPGQVAQNGQPDSIIQ
Function Induces apoptosis.
Tissue Specificity Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Gastric cancer DISXGOUK Strong Altered Expression [1]
Lung cancer DISCM4YA Strong Biomarker [2]
Lung carcinoma DISTR26C Strong Biomarker [2]
Neoplasm DISZKGEW Strong Biomarker [1]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [2]
Stomach cancer DISKIJSX Strong Altered Expression [1]
Bone osteosarcoma DIST1004 moderate Biomarker [3]
Carcinoma DISH9F1N moderate Biomarker [3]
Osteosarcoma DISLQ7E2 moderate Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Nuclear apoptosis-inducing factor 1 (NAIF1). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Nuclear apoptosis-inducing factor 1 (NAIF1). [6]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Nuclear apoptosis-inducing factor 1 (NAIF1). [5]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Nuclear apoptosis-inducing factor 1 (NAIF1). [7]
------------------------------------------------------------------------------------

References

1 Overexpression of nuclear apoptosis-inducing factor 1 altered the proteomic profile of human gastric cancer cell MKN45 and induced cell cycle arrest at G1/S phase.PLoS One. 2014 Jun 13;9(6):e100216. doi: 10.1371/journal.pone.0100216. eCollection 2014.
2 Upregulation of miR-24 promotes cell proliferation by targeting NAIF1 in non-small cell lung cancer.Tumour Biol. 2015 May;36(5):3693-701. doi: 10.1007/s13277-014-3008-4. Epub 2015 Mar 1.
3 NAIF1 suppresses osteosarcoma progression and is regulated by miR-128.Cell Biochem Funct. 2018 Dec;36(8):443-449. doi: 10.1002/cbf.3365. Epub 2018 Nov 8.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.