Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0IEAAR)

• DOT Name: Vesicle transport protein SFT2C (SFT2D3)
• Synonyms: SFT2 domain-containing protein 3
• Gene Name: SFT2D3
• Related Disease: Colorectal carcinoma
• UniProt ID: SFT2C_HUMAN
• Pfam ID: PF04178
• Sequence:
  MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAES
  AAAGLTCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALAL
  AGSALLRGGAACGRLLRCEEAPSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAAL
  LAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV
• Function: May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Vesicle transport protein SFT2C (SFT2D3).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Vesicle transport protein SFT2C (SFT2D3).	[8]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[5]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Vesicle transport protein SFT2C (SFT2D3).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Vesicle transport protein SFT2C (SFT2D3).	[10]

References

• [1] Epigenomic analysis of aberrantly methylated genes in colorectal cancer identifies genes commonly affected by epigenetic alterations. Ann Surg Oncol. 2011 Aug;18(8):2338-47.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.