Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0UYJMF)

• DOT Name: Protein MENT (C1ORF56)
• Synonyms: Methylated in normal thymocytes protein
• Gene Name: C1ORF56
• Related Disease:
  Gastric cancer
  Stomach cancer
  Lymphoma
• UniProt ID: MENT_HUMAN
• Pfam ID: PF15322
• Sequence:
  MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKT
  RIILEDENDAMADADRLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDST
  SRELPSATPNTAGSSSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGS
  TPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMSRSRSGKLHGLSGRLRVGALSQ
  LRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSL
  PPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR
• Function: Involved in control of cellular proliferation. Onconcogenic modifier contributing to the tumor suppressor function of DNMT3B.
• Tissue Specificity: Plasma. Overexpressed in lymphomas.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Strong	Biomarker	[1]
Stomach cancer	DISKIJSX	Strong	Biomarker	[1]
Lymphoma	DISN6V4S	Limited	Altered Expression	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein MENT (C1ORF56).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein MENT (C1ORF56).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Protein MENT (C1ORF56).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein MENT (C1ORF56).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein MENT (C1ORF56).	[9]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein MENT (C1ORF56).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein MENT (C1ORF56).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein MENT (C1ORF56).	[8]

References

• [1] Integrative genomics analysis reveals the multilevel dysregulation and oncogenic characteristics of TEAD4 in gastric cancer.Carcinogenesis. 2014 May;35(5):1020-7. doi: 10.1093/carcin/bgt409. Epub 2013 Dec 9.
• [2] Loss of Dnmt3b function upregulates the tumor modifier Ment and accelerates mouse lymphomagenesis.J Clin Invest. 2012 Jan;122(1):163-77. doi: 10.1172/JCI57292. Epub 2011 Dec 1.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.