Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT10N6Z2)

DOT Name Protein sel-1 homolog 3 (SEL1L3)
Synonyms Suppressor of lin-12-like protein 3; Sel-1L3
Gene Name SEL1L3
UniProt ID
SE1L3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08238
Sequence
MQRRGAGLGWPRQQQQQPPPLAVGPRAAAMVPSGGVPQGLGGRSACALLLLCYLNVVPSL
GRQTSLTTSVIPKAEQSVAYKDFIYFTVFEGNVRNVSEVSVEYLCSQPCVVNLEAVVSSE
FRSSIPVYKKRWKNEKHLHTSRTQIVHVKFPSIMVYRDDYFIRHSISVSAVIVRAWITHK
YSGRDWNVKWEENLLHAVAKNYTLLQTIPPFERPFKDHQVCLEWNMGYIWNLRANRIPQC
PLENDVVALLGFPYASSGENTGIVKKFPRFRNRELEATRRQRMDYPVFTVSLWLYLLHYC
KANLCGILYFVDSNEMYGTPSVFLTEEGYLHIQMHLVKGEDLAVKTKFIIPLKEWFRLDI
SFNGGQIVVTTSIGQDLKSYHNQTISFREDFHYNDTAGYFIIGGSRYVAGIEGFFGPLKY
YRLRSLHPAQIFNPLLEKQLAEQIKLYYERCAEVQEIVSVYASAAKHGGERQEACHLHNS
YLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEK
AVKRLSSIDGLHQISSIVPFLTDSSCCGYHKASYYLAVFYETGLNVPRDQLQGMLYSLVG
GQGSERLSSMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRL
KDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEWYAKG
ALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYHKFKKNY
AKAAKYWLKAEEMGNPDASYNLGVLHLDGIFPGVPGRNQTLAGEYFHKAAQGGHMEGTLW
CSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGSWHEALLYYVLA
AETGIEVSQTNLAHICEERPDLARRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDLYYYG
HQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIEEGTIIPHHILDFLEIDSTLHSNNIS
ILQELYERCWSHSNEESFSPCSLAWLYLHLRLLWGAILHSALIYFLGTFLLSILIAWTVQ
YFQSVSASDPPPRPSQASPDTATSTASPAVTPAADASDQDQPTVTNNPEPRG

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Protein sel-1 homolog 3 (SEL1L3). [1]
------------------------------------------------------------------------------------
22 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein sel-1 homolog 3 (SEL1L3). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein sel-1 homolog 3 (SEL1L3). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Protein sel-1 homolog 3 (SEL1L3). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein sel-1 homolog 3 (SEL1L3). [5]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protein sel-1 homolog 3 (SEL1L3). [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Protein sel-1 homolog 3 (SEL1L3). [7]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Protein sel-1 homolog 3 (SEL1L3). [8]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Protein sel-1 homolog 3 (SEL1L3). [9]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Protein sel-1 homolog 3 (SEL1L3). [10]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Protein sel-1 homolog 3 (SEL1L3). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protein sel-1 homolog 3 (SEL1L3). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Protein sel-1 homolog 3 (SEL1L3). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Protein sel-1 homolog 3 (SEL1L3). [14]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 increases the expression of Protein sel-1 homolog 3 (SEL1L3). [9]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Protein sel-1 homolog 3 (SEL1L3). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Protein sel-1 homolog 3 (SEL1L3). [16]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Protein sel-1 homolog 3 (SEL1L3). [17]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Protein sel-1 homolog 3 (SEL1L3). [18]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Protein sel-1 homolog 3 (SEL1L3). [18]
acrolein DMAMCSR Investigative acrolein increases the expression of Protein sel-1 homolog 3 (SEL1L3). [18]
1,6-hexamethylene diisocyanate DMLB3RT Investigative 1,6-hexamethylene diisocyanate increases the expression of Protein sel-1 homolog 3 (SEL1L3). [18]
NSC-1771 DMNXDGQ Investigative NSC-1771 increases the expression of Protein sel-1 homolog 3 (SEL1L3). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
8 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
9 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
10 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
11 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
16 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
17 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
18 Gene expressions changes in bronchial epithelial cells: markers for respiratory sensitizers and exploration of the NRF2 pathway. Toxicol In Vitro. 2014 Mar;28(2):209-17.