Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT15D7GH)

DOT Name Cold shock domain-containing protein E1 (CSDE1)
Synonyms N-ras upstream gene protein; Protein UNR
Gene Name CSDE1
Related Disease
Complex neurodevelopmental disorder ( )
Autism ( )
Congenital anemia ( )
Diamond-Blackfan anemia ( )
Intellectual disability ( )
Matthew-Wood syndrome ( )
Advanced cancer ( )
Melanoma ( )
Neoplasm ( )
UniProt ID
CSDE1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1WFQ; 1X65; 2YTV; 2YTX; 2YTY
Pfam ID
PF00313 ; PF12901
Sequence
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNL
QDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAP
GQSPTGSVCYERNGEVFYLTYTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLK
KKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKE
VATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQNDPLPGRIKVDFVIPKELPFG
DKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREMGVIAAMRDGF
GFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGS
TSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDK
EIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGK
VIRPLRSVDPTQTEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLG
QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFS
VILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPD
NSMGFGAERKIRQAGVID
Function
RNA-binding protein involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Required for efficient formation of stress granules ; (Microbial infection) Required for internal initiation of translation of human rhinovirus RNA.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Complex neurodevelopmental disorder DISB9AFI Definitive Autosomal dominant [1]
Autism DISV4V1Z Strong Biomarker [2]
Congenital anemia DISTW0J6 Strong Altered Expression [3]
Diamond-Blackfan anemia DISI2SNW Strong Altered Expression [3]
Intellectual disability DISMBNXP Strong Biomarker [2]
Matthew-Wood syndrome DISA7HR7 Strong Altered Expression [4]
Advanced cancer DISAT1Z9 Limited Biomarker [5]
Melanoma DIS1RRCY Limited Biomarker [5]
Neoplasm DISZKGEW Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cold shock domain-containing protein E1 (CSDE1). [6]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of Cold shock domain-containing protein E1 (CSDE1). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Cold shock domain-containing protein E1 (CSDE1). [12]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cold shock domain-containing protein E1 (CSDE1). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cold shock domain-containing protein E1 (CSDE1). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Cold shock domain-containing protein E1 (CSDE1). [10]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate decreases the expression of Cold shock domain-containing protein E1 (CSDE1). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Cold shock domain-containing protein E1 (CSDE1). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Cold shock domain-containing protein E1 (CSDE1). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Disruptive variants of CSDE1 associate with autism and interfere with neuronal development and synaptic transmission.Sci Adv. 2019 Sep 25;5(9):eaax2166. doi: 10.1126/sciadv.aax2166. eCollection 2019 Sep.
3 Csde1 binds transcripts involved in protein homeostasis and controls their expression in an erythroid cell line.Sci Rep. 2018 Feb 8;8(1):2628. doi: 10.1038/s41598-018-20518-7.
4 UNR/CDSE1 expression as prognosis biomarker in resectable pancreatic ductal adenocarcinoma patients: A proof-of-concept.PLoS One. 2017 Aug 1;12(8):e0182044. doi: 10.1371/journal.pone.0182044. eCollection 2017.
5 UNR/CSDE1 Drives a Post-transcriptional Program to Promote Melanoma Invasion and Metastasis.Cancer Cell. 2016 Nov 14;30(5):694-707. doi: 10.1016/j.ccell.2016.10.004. Epub 2016 Oct 27.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
10 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
11 Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.