Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT19XBFD)

DOT Name Protein ripply1 (RIPPLY1)
Gene Name RIPPLY1
Related Disease
Pancreatitis ( )
Cerebellar ataxia, intellectual disability, and dysequilibrium ( )
Chronic pancreatitis ( )
UniProt ID
RIPP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14998
Sequence
MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPW
LSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRSFDYLYSAGEILLQ
NFPVQATINLYEDSDSEEEEEDEEQEDEEEK
Function
Plays a role in somitogenesis. Essential for transcriptional repression of the segmental patterning genes, thus terminating the segmentation program in the presomitic mesoderm, and also required for the maintenance of rostrocaudal polarity in somites.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Pancreatitis DIS0IJEF Strong Genetic Variation [1]
Cerebellar ataxia, intellectual disability, and dysequilibrium DIS9923V Limited Autosomal recessive [2]
Chronic pancreatitis DISBUOMJ Limited Genetic Variation [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Protein ripply1 (RIPPLY1). [4]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Protein ripply1 (RIPPLY1). [5]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Protein ripply1 (RIPPLY1). [6]
------------------------------------------------------------------------------------

References

1 Common genetic variants in the CLDN2 and PRSS1-PRSS2 loci alter risk for alcohol-related and sporadic pancreatitis. Nat Genet. 2012 Dec;44(12):1349-54. doi: 10.1038/ng.2466. Epub 2012 Nov 11.
2 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
3 Polymorphisms at PRSS1-PRSS2 and CLDN2-MORC4 loci associate with alcoholic and non-alcoholic chronic pancreatitis in a European replication study.Gut. 2015 Sep;64(9):1426-33. doi: 10.1136/gutjnl-2014-307453. Epub 2014 Sep 24.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.