Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT232N7Q)

• DOT Name: RNA-binding Raly-like protein (RALYL)
• Synonyms: hRALYL; Heterogeneous nuclear ribonucleoprotein C-like 3; hnRNP core protein C-like 3
• Gene Name: RALYL
• Related Disease:
  Neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Renal cell carcinoma
  Neuroblastoma
• UniProt ID: RALYL_HUMAN
• Pfam ID: PF00076
• Sequence:
  MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFV
  QYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLS
  VGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSR
  STASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLV
  LIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
• Tissue Specificity: Widely expressed, with highest levels in brain.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[2]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[3]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[3]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of RNA-binding Raly-like protein (RALYL).	[4]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of RNA-binding Raly-like protein (RALYL).	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of RNA-binding Raly-like protein (RALYL).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RNA-binding Raly-like protein (RALYL).	[7]

References

• [1] Acquired genetic alterations in tumor cells dictate the development of high-risk neuroblastoma and clinical outcomes.BMC Cancer. 2015 Jul 10;15:514. doi: 10.1186/s12885-015-1463-y.
• [2] An integrative approach to identify YB-1-interacting proteins required for cisplatin resistance in MCF7 and MDA-MB-231 breast cancer cells. Cancer Sci. 2011 Jul;102(7):1410-7. doi: 10.1111/j.1349-7006.2011.01948.x. Epub 2011 May 5.
• [3] RALY RNA binding protein-like reduced expression is associated with poor prognosis in clear cell renal cell carcinoma.Asian Pac J Cancer Prev. 2012;13(7):3403-8. doi: 10.7314/apjcp.2012.13.7.3403.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.