Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2CDBH6)

DOT Name	DnaJ homolog subfamily B member 8 (DNAJB8)
Gene Name	DNAJB8
Related Disease	Advanced cancer ( ) Clear cell renal carcinoma ( ) Colorectal carcinoma ( ) Neoplasm ( ) Renal cell carcinoma ( )
UniProt ID	DNJB8_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2DMX
Pfam ID	PF00226
Sequence	MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK KRSLYDRAGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFN SDRGGRGHGLRGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMDSK
Function	Efficient suppressor of aggregation and toxicity of disease-associated polyglutamine proteins.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of DnaJ homolog subfamily B member 8 (DNAJB8).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of DnaJ homolog subfamily B member 8 (DNAJB8).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of DnaJ homolog subfamily B member 8 (DNAJB8).	[6]
------------------------------------------------------------------------------------

References

1	Cellular stress induces cancer stem-like cells through expression of DNAJB8 by activation of heat shock factor 1.Cancer Sci. 2018 Mar;109(3):741-750. doi: 10.1111/cas.13501. Epub 2018 Feb 20.
2	HSP DNAJB8 controls tumor-initiating ability in renal cancer stem-like cells.Cancer Res. 2012 Jun 1;72(11):2844-54. doi: 10.1158/0008-5472.CAN-11-3062. Epub 2012 May 2.
3	Heat shock protein DNAJB8 is a novel target for immunotherapy of colon cancer-initiating cells.Cancer Sci. 2014 Apr;105(4):389-95. doi: 10.1111/cas.12362. Epub 2014 Feb 24.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.