Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2H4HAP)

DOT Name Putative transmembrane protein INAFM2 (INAFM2)
Synonyms InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1
Gene Name INAFM2
Related Disease
Adult lymphoma ( )
AIDS-related lymphoma ( )
Lymphoma ( )
Pediatric lymphoma ( )
UniProt ID
INAM2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15018
Sequence
MKERDAAPAERGKPATYTGDKKAKMAAKTNKKWVRLATVFAYVLSVSLAAIVLAVYYSLI
WQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAP
PEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult lymphoma DISK8IZR Strong Biomarker [1]
AIDS-related lymphoma DISSLRAU Strong Biomarker [1]
Lymphoma DISN6V4S Strong Biomarker [1]
Pediatric lymphoma DIS51BK2 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Putative transmembrane protein INAFM2 (INAFM2). [2]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Putative transmembrane protein INAFM2 (INAFM2). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Putative transmembrane protein INAFM2 (INAFM2). [4]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Putative transmembrane protein INAFM2 (INAFM2). [5]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Putative transmembrane protein INAFM2 (INAFM2). [2]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Putative transmembrane protein INAFM2 (INAFM2). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Establishment and characterization of a novel VEGF-producing HHV-8-unrelated PEL-like lymphoma cell line, OGU1.Eur J Haematol. 2016 Feb;96(2):144-51. doi: 10.1111/ejh.12559. Epub 2015 Apr 21.
2 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.